KEGG   Addendum: EFG03980
Entry
EFG03980          CDS       T10000                                 

Name
(KEGG) labda-7,13-dienyl diphosphate synthase (EC:5.5.1.30)
  KO
K03463  labda-7,13-dienyl diphosphate synthase [EC:5.5.1.30]
Taxonomy
TAX:1901
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces clavuligerus)
SSDB
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N
Other DBs
NCBI-ProteinID: EFG03980
GB: CM000914
UniProt: D5SJ87
AA seq 545 aa
MPVDVGTLPPPAPREAVSAAAHLLASVDGDPWGRTSPTVYETARVHAWAPHLPGRDRRVT
WLLDQQRAGGLWGDGPPAYQVLPTLAAVTALLAELDRHPEAGHSSLGGRLAAAVAAGLDT
LHGLSHHDPLPDTAAVELLVPGLITEVNDRLDAIDPEAAHPALAPVPHGRRLTAVHGIPA
LPRHRLAERLARFARLPVKLHHCFEALAPVCPPGLVPARPDHLLGSSSAATAAWLATATA
APGAPGLDRLLRSTAARYGGLFPETARITVFERLWVLTTLHRAGLLATFEPLARRWVSAL
AAPGGVPGVPGFEPDADDTAVTLHLATELGVPYRPEVLDPFRTGDHFACYLGEDTGSVST
NAHVLLALGTWTRHHPDTADHGNTIRLLGRWLVERQHGDGHWDDKWHASPYYATAKVTAA
LSRHGGPEAADALRRAARWVRETRRTDGSWGIWGGTAEETAYAAQILLDAPEPPTDVLGC
AHAHLTARADDDGPPPALWHDKTLFAPDAIVRAEVLSTLRRLDRRLPAPAPVPPGFDAAR
TGPAD
Reference
  Authors
Medema MH, Trefzer A, Kovalchuk A, van den Berg M, Muller U, Heijne W, Wu L, Alam MT, Ronning CM, Nierman WC, Bovenberg RA, Breitling R, Takano E
  Title
The sequence of a 1.8-mb bacterial linear plasmid reveals a rich evolutionary reservoir of secondary metabolic pathways.
  Journal
Genome Biol Evol 2:212-24 (2010)
DOI:10.1093/gbe/evq013
Reference
  Authors
Yamada Y, Komatsu M, Ikeda H
  Title
Chemical diversity of labdane-type bicyclic diterpene biosynthesis in Actinomycetales microorganisms.
  Journal
J Antibiot (Tokyo) 69:515-23 (2016)
DOI:10.1038/ja.2015.147

DBGET integrated database retrieval system