KEGG   Addendum: EFG03981
Entry
EFG03981          CDS       T10000                                 

Name
(KEGG) labda-7,13(16),14-triene synthase (EC:4.2.3.192)
  KO
K22929  labda-7,13(16),14-triene synthase [EC:4.2.3.192]
Taxonomy
TAX:1901
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces clavuligerus)
SSDB
Motif
Pfam: Terpene_syn_C_2
Other DBs
NCBI-ProteinID: EFG03981
GB: CM000914
UniProt: B5GRC8
AA seq 343 aa
MGRRARSARSFGVSPLWGGVSVRSGDRGEAAVGGLWEVPDFWGLFPSRISPLAGEVESGT
RVWLDGWRLVEEAGPGERLKASKVGRLVALAYPDAPADLLRWAADLFAWLTAFDDVHVEA
PGVTTAELGPHMASFVGVLETGTAPGAAPTPFPAALAELLDRARELLTPLQEERVRARLG
KVFVAMLWEITTRERTVSTAEYETMRPHTFFSAVGAALVEPCAGLDLSHGVRADPGVRRL
TQALATLWERTNDLYSFAYEQRALGSVPRTLPWLIAQERGLPLDAAFAEAGRWCEEEAVL
AHRLIGELSASAREGVPEYAGAVAHAIGGTRRLYEVSDRWREE
Reference
  Authors
Medema MH, Trefzer A, Kovalchuk A, van den Berg M, Muller U, Heijne W, Wu L, Alam MT, Ronning CM, Nierman WC, Bovenberg RA, Breitling R, Takano E
  Title
The sequence of a 1.8-mb bacterial linear plasmid reveals a rich evolutionary reservoir of secondary metabolic pathways.
  Journal
Genome Biol Evol 2:212-24 (2010)
DOI:10.1093/gbe/evq013
Reference
  Authors
Yamada Y, Komatsu M, Ikeda H
  Title
Chemical diversity of labdane-type bicyclic diterpene biosynthesis in Actinomycetales microorganisms.
  Journal
J Antibiot (Tokyo) 69:515-23 (2016)
DOI:10.1038/ja.2015.147

DBGET integrated database retrieval system