KEGG   Addendum: KHL76346
Entry
KHL76346          CDS       T10000                                 

Symbol
PpSQ1_00405
Name
(KEGG) sulfoquinovose 1-dehydrogenase (EC:1.1.1.390)
Taxonomy
TAX:303
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas putida)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Other DBs
NCBI-ProteinID: KHL76346
GB: JTCJ01000004
UniProt: P0DOV5
AA seq 260 aa
MNRHTDTHYPSLADKVVLISGGASGIGRAFVEAFVAQGSRVAFLDLDAEAGQGLAHALGA
NSLFLPCDVRDIERLKACVAEVERTWGAVDVLINNAARDDRHALADVSVEYWDERMQTNL
RHAFFAAQAVAPGMARRGSGAIINMGSISWMRGRPGMVCYTTAKAALNGMTRTLARELGG
QGIRINSLVPGAIRTERQDAMWAADPAGLEAASQAFIDQQMLKFRLDASDCARLALFLAS
DDSRGCTGQNFVVDAGLSIQ
Reference
  Authors
Felux AK, Franchini P, Schleheck D
  Title
Permanent draft genome sequence of sulfoquinovose-degrading Pseudomonas putida strain SQ1.
  Journal
Stand Genomic Sci 10:42 (2015)
DOI:10.1186/s40793-015-0033-x
Reference
  Authors
Felux AK, Spiteller D, Klebensberger J, Schleheck D
  Title
Entner-Doudoroff pathway for sulfoquinovose degradation in Pseudomonas putida SQ1.
  Journal
Proc Natl Acad Sci U S A 112:E4298-305 (2015)
DOI:10.1073/pnas.1507049112

DBGET integrated database retrieval system