KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER402C
Entry
AGOS_AER402C      CDS       T00167                                 

Name
(RefSeq) AER402Cp
  KO
K10868  DNA repair protein XRS2
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago03440  Homologous recombination
ago03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ago00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AGOS_AER402C
   03450 Non-homologous end-joining
    AGOS_AER402C
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ago03400]
    AGOS_AER402C
DNA repair and recombination proteins [BR:ago03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     AGOS_AER402C
   NHEJ (non-homologous end-joining)
    MRX complex
     AGOS_AER402C
SSDB
Motif
Pfam: BRCT Yop-YscD_cpl FHA
Other DBs
NCBI-GeneID: 4621473
NCBI-ProteinID: NP_985257
UniProt: Q755W6
Position
V:complement(1407086..1409695)
AA seq 869 aa
MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIEEKGVSRTHLRLEVIDDH
VNILLLGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNTLLQ
EDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEFLKQF
TALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKYTLEIGGG
TVHFCHDINDLSACLKTIPINGALALKYDHGISAEVKKVDDTRYCEVLHSHGIQLFTVHE
LTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEMKQESLSPISLGNTTIKDLPRKD
KTRKRLKKPQPLDSLSFFAGGLSRQNSSIGGTADLVKQESMSLGADTHYGSPNDVQSLPA
TQSPKKRRRPKVEPLGNLMTSQLQKAFDDPTISSAKVSPTEQEIIPVRESQAKKTPDPIG
AFNGTSQKGSIESNSRKRQPSPGYPYEPLPAGVGNGDILNKQWKSLDEQPPSKKPRMQET
DLYSEVMSGSSEEYREELTRSKLNSLDEESIKSRKRTSSEKPVNSCKRRQAPAVPEQNIV
DAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQQHTVDTVGSSPL
TFARKNYKNFKKVWPKYMNRKNSPETRNATAISNRKYLPLELYETDLQSRTLFEDGAPPR
QKDNISRSTSTSGLSNDLASNRGKDHPAPGSLFSNHALLGNDNAGPEPIFNFSSRSREDT
NSPTASPAPNLTHDNTLFVVDDENEDGDGMADTSIAQRVSRERHATTKPAEPDTAEPRHT
RRKHAPRPSAAAADSDEDGEPTFAFKRAR
NT seq 2610 nt   +upstreamnt  +downstreamnt
atgtgggttttcaaatgtaactatcaaaagagcggtcagcttggtgcactgcagaatatc
tcctgcgctttgtgtccagagagagagtttatcgtaggaagagcaagcaaaagtacacta
gttatagaggaaaaaggtgtatcaagaacacatctccgactagaggtaatagacgaccat
gtcaatattctgctattgggatctcagctgaaagttggtggcgaagatgcatctaaggga
tcggtgttaccgtttggaccatctcagagccctgttattctggaagtgggatcacattcc
gtccaatgcatattggagtgggctcaatgggagttcaaggtcccgaatactttgttacaa
gaagaccctgctttgcttgaggtaattaaagggttaggaatacgagtggtgacctctttt
tcgaaggccactacacatcatattattagaccccatgaagatgaccaagattacgaaaag
tatttgtttgcacttgttaaaggcataccaatattgcatctcgaatttctgaaacaattt
accgctcttcttcgacagcctgttaccgattttgacccacagctacgcagtatacaagag
cagcattacgcctttagaggctttactaagaaagccgcagacctgaatgggttgcacttt
atagtaaacagaaaacatgattttgaaatgctaaaatatacattggagataggaggtgga
acggtgcatttttgccatgacattaatgacttgagcgcatgtctcaagacaatacctatt
aatggagctcttgcattgaaatatgatcatgggatatctgcagaggtaaagaaagttgac
gatacacgatattgtgaggtcttgcactcgcatggtatacagttgtttactgtccatgaa
ctaacgaaagccatactgtacgataagcttgctcagttgctaagtaagaggccacccact
atgatgaaattagtggaaccagtgccatctactatatctcaaacacaagaaatgaaacaa
gaatctttatcacccatctcattgggaaatacgactatcaaggatttaccgcgtaaagac
aaaacaaggaaacggctcaagaaacctcagcctctggatagtttgtcattttttgcaggt
ggtctatcgcggcagaatagctcgataggtggtacagctgaccttgttaaacaagaaagc
atgagcttaggagcagatactcattatggaagtccaaacgatgtccaatcgttacccgcg
acccaaagcccgaaaaagaggaggcgtccaaaggttgaaccgctagggaatttaatgacc
tctcaattgcaaaaagctttcgatgatccaactatttcgagcgcgaaagtatcgcccact
gagcaggaaattatcccagttcgtgaatcacaagctaaaaaaacccccgaccccattggg
gcatttaatggcacttcacagaaggggagtatagaatcgaactcaaggaagaggcagccg
agccctggatatccctacgaacccctaccggccggagtaggtaatggagatatcctcaat
aagcaatggaaatccttagatgagcagccaccttctaaaaaacctagaatgcaagaaaca
gacctgtactcggaagtgatgtcgggaagtagcgaagagtatcgggaggaactaaccaga
tcaaaacttaattccttagatgaggaatccattaagagccgaaagagaacaagttcagaa
aagcctgtgaatagttgtaaacgtcggcaggctcctgctgtaccggaacaaaacatagtt
gatgctatcaaacaaataaaggaacgtgaagtcaaccgcataagaaccacaatagtagaa
ctgggccccgaggaattaaccgaagatgctataaggcaacttaaatcgttagcgattgtc
cagccagtagatatgctcaggcaacaacatactgtagatacagttggttcgtcgccatta
acctttgcacggaagaactacaagaattttaagaaggtgtggcccaaatatatgaatcgc
aagaattcgcctgaaacaaggaatgctaccgcgatcagtaacagaaaatatctcccattg
gaactttatgaaactgatcttcagagccggacgttatttgaagatggtgcgcctccacga
cagaaggacaatatttctcgttctacttctacaagtggcctctcgaacgaccttgcaagt
aaccgcggaaaggaccatccggctcctggaagtttattttcgaaccatgcattactagga
aatgataacgcaggccctgagccaatcttcaattttagttcccgttcccgcgaggacaca
aattctcctacagcgtcaccagctccaaacctgacacatgataacactttatttgtggta
gatgacgaaaacgaagatggcgacggaatggctgatacaagcattgcccagagagtctca
agggagagacatgctactactaaacctgcggaacccgatacggctgagccacgacacact
cgtcgaaaacatgctcccagaccatccgcggccgcagcagacagcgatgaagacggcgaa
ccaacgttcgcatttaaacgcgcacgatga

DBGET integrated database retrieval system