KEGG   Agrobacterium fabacearum H13-3: AGROH133_12258
Entry
AGROH133_12258    CDS       T01432                                 

Name
(GenBank) lysine exporter protein
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
agr  Agrobacterium fabacearum H13-3
Brite
KEGG Orthology (KO) [BR:agr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:agr02000]
    AGROH133_12258
Transporters [BR:agr02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   AGROH133_12258
SSDB
Motif
Pfam: LysE MarC DPM3 DUF373 TerC Keratin_assoc LptF_LptG
Other DBs
NCBI-ProteinID: ADY66919
UniProt: F0LCV9
Position
linear:1299482..1300111
AA seq 209 aa
MELMLVLKSIVLGLAVAAPLGPIGALCINRTLERGFWAGVAGGLGTALADAVYASLAALG
FSAFAATLATIDTPLKIVGGLFMLWLGWKSLRPKPLAEAAKVGARDLLGTITATFFLTIT
NPMTILSFAAIFAGLGLADASGATSAFFVVAGVFLGSLLWWFMLSGGVAFARQRLPTTFA
RWVSRLSGVILVLFGLFALGSLAWGMMAH
NT seq 630 nt   +upstreamnt  +downstreamnt
atggaactgatgctcgttttgaaaagcattgtgctgggccttgcggtcgcagccccgctc
ggccccattggcgccctctgcatcaaccggacccttgagcgcgggttctgggcgggagtg
gcaggtggccttgggactgctctggcggatgccgtgtatgccagcctcgcagcactcggc
ttttccgctttcgcggcgaccctcgcgacaatcgatacgccgctcaaaatcgtcggcggc
cttttcatgctgtggctcggctggaaaagcctgaggcccaaacctctggcagaagcggcc
aaggttggagcgcgcgatctgctcggcaccatcaccgcgacctttttcctgacgattacc
aaccccatgacgattctgtcctttgcagcaattttcgcgggtctcggccttgctgacgca
tcgggagcgacgagcgctttttttgtggtcgcgggcgtttttctagggtctttattgtgg
tggttcatgttgagcggcggcgttgcatttgcccggcagcgccttcccaccacctttgcc
cgctgggtttcccgcctgtccggagtgatccttgtcttattcgggctttttgccctaggt
tcacttgcctggggcatgatggctcattga

DBGET integrated database retrieval system