KEGG   Arachis hypogaea (peanut): 112714722
Entry
112714722         CDS       T07294                                 

Name
(RefSeq) (3S,6E)-nerolidol synthase 1
  KO
K24668  neryl diphosphate diphosphatase [EC:3.7.1.27]
Organism
ahf  Arachis hypogaea (peanut)
Brite
KEGG Orthology (KO) [BR:ahf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    112714722
Enzymes [BR:ahf01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.27  neryl diphosphate diphosphatase
     112714722
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 112714722
NCBI-ProteinID: XP_025622166
Position
Arahy.10
AA seq 520 aa
MDILYSKQAVLLKEAKHVMKKLISEDPMESLCMVDLIQRLGIEHHFQEHIEAALEKQHFI
VITDPIDFVQSHQLDEVALSFRLLRQGGYSVNADIFERLKKNKVQLREAYGEDVKSLIAV
NEAAQLSIGEEDTSLEDVGRLCRELLHSWLSRHHHHHEAQYVAISLQQPLHHNLPRFVDK
TILLRNFNPDKESVCFMELAEINSCIVRLMNQHEGLQVSKWWKGEAMSKEPKFAEYEALK
WYMWSMACFTDPSFSDQRLELTKPISLVYIIDDIFDVYGTLDQLILFTDAVKRWELTGTE
HLPQFMKNCLSALYEITNAFAEKIYKKHGLNPINTLKKSWVQLLNASLEGAHWSDCGELP
KSEEYLKHATVSTGVHVVLVHSFFLFHQNITKETLAILDDFPDIIYSVAKILRLCDDLEG
HKNKNQSGFDGSYIECYMREHQETSAEDAERHVEELISMEWKRLNRQVLCRDQQFPSSFT
KFCMSAARMVPLMYHYRTNPSLSNLHQHVKSIANAGVANM
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggatattttatattccaagcaagctgtgttgctgaaggaggctaagcatgtaatgaag
aaacttattagcgaggatccaatggagagtttgtgcatggttgacttaatccaaaggctt
ggcattgagcaccactttcaagagcacattgaagctgcacttgagaagcaacatttcata
gtgatcacagatccgattgattttgtccaaagccatcaacttgacgaagttgcactctca
ttccgtttactcagacagggaggttattccgttaatgcagatatatttgagaggttgaaa
aagaacaaagtgcagttgagagaagcatatggtgaagatgtgaagagtctcatagcggta
aatgaagcagcgcagctaagcattggagaagaagatacttctcttgaggatgtggggcgc
ctctgccgcgagcttcttcattcatggctgtcaaggcatcatcatcatcatgaagctcaa
tatgttgcaatctctctccagcaaccacttcatcacaacttgcctagattcgtggacaaa
accatcttgcttaggaatttcaatcccgacaaggaatctgtgtgttttatggaacttgca
gaaatcaattcctgcatagttaggctcatgaaccagcatgaaggccttcaagtttcaaaa
tggtggaaaggggaggctatgtcgaaggagccgaaatttgcagagtatgaagctctaaaa
tggtacatgtggtccatggcatgctttacagatccgagcttttcagaccaaagacttgag
ctcaccaaacctatctctctggtctacatcattgatgacattttcgatgtttatggcacg
ttggatcagcttattctatttactgatgcggttaagagatgggaattgaccggaacagag
caccttccccaattcatgaaaaattgtttaagtgctctatatgaaattacaaacgctttc
gccgaaaagatctacaaaaagcatggattgaatcctataaatacccttaaaaaatcgtgg
gtgcaattgttgaatgcctccttggaaggggcacattggtctgattgtggtgaattgcca
aagtcagaggagtacttgaagcatgcaactgtaagcacaggagtgcacgtggtgcttgtc
cattcatttttccttttccatcaaaatataacaaaggaaactcttgcaattttagacgac
tttccagacattatatattccgtcgcaaaaatccttcgtctttgtgatgacttagaagga
cacaagaataaaaatcaaagtgggtttgatgggtcatacattgagtgctacatgagagaa
caccaagagacttcagcagaagatgcagaaaggcatgttgaggagctgatttcaatggaa
tggaagcgtctcaatcgacaagtgttgtgcagagatcagcaatttccatcgtcatttacc
aaattctgcatgagtgctgctagaatggtccctctaatgtaccattaccgcaccaatcca
agcctttccaacctacatcaacatgtcaagtctattgctaatgctggtgttgcaaacatg
tga

DBGET integrated database retrieval system