KEGG   Arachis hypogaea (peanut): 112783339
Entry
112783339         CDS       T07294                                 

Name
(RefSeq) (3S,6E)-nerolidol synthase 1 isoform X1
  KO
K24668  neryl diphosphate diphosphatase [EC:3.7.1.27]
Organism
ahf  Arachis hypogaea (peanut)
Brite
KEGG Orthology (KO) [BR:ahf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    112783339
Enzymes [BR:ahf01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.27  neryl diphosphate diphosphatase
     112783339
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 112783339
NCBI-ProteinID: XP_025682048
Position
Arahy.20
AA seq 517 aa
MDILYAKQTVILKEAKQVMKKLISEDPMESLYMVDLIQRLGIEHHFQEDIEAALEKQHFI
VSTDPIDFFQSHQLDNVALSFRLLRQGGYFLNADIFERLKNNKVQFREEYGEDVKSLVAV
HEAAQLSIGEEDTSLEDVGRLCRDLLHSWLSRHHHHHEAQYVAISLQQPLHHNLPRFMDK
TILLRNFKPDKESVCFMELAEINSSIVRLMNQHEALQVSKWWKGEAMSKEPTFGGYEALK
WYMWPMACFTDPSFSEQRIELTKCISLVYLIDDLFDVYGTLDQLILFTDAVKRWELVGTE
QLPEFMKICLRALYEITNDFAEKVYKMQGLNPIDTVKTSWIRLTNAFLEERHWLNFGELP
KTEEYLKHAVVSTGVHVVLVHAFFLFHQNITHKSLAILDDFPNIIYSVAKILRLSDDLEG
YKNKNETGFDGSYIECYMREHQEVSAEDAQKHVEELISMEWKRLNRQVMLSTDHQFSSSY
TKFCLNAARMVPLMYHYRTNPSLSNLHQYVKSIAKCQ
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggatattttgtacgcaaaacaaactgtgatcctgaaggaggctaagcaagtaatgaag
aaacttattagcgaggatccaatggagagtttgtacatggttgacttaatccaaaggctt
ggcattgaacaccactttcaagaggacattgaagctgcacttgagaagcaacatttcata
gtgagcacagatcccattgattttttccaaagccatcaacttgacaatgttgcactctca
ttccgtttactcagacaaggaggttatttccttaatgcagatatatttgagaggttgaaa
aataacaaagtgcagttcagagaagaatatggtgaagatgtgaagagtctcgtagcggta
catgaagcagcgcagctaagcattggagaagaagatacttctcttgaggatgtggggcgc
ctctgccgcgatcttcttcattcatggctgtcaaggcatcatcatcatcatgaagctcaa
tatgttgcaatctctctccagcaaccacttcatcacaacttgcctagattcatggacaaa
accatcttgcttaggaatttcaagcccgacaaggaatctgtgtgttttatggaacttgca
gaaatcaattccagcatagttaggctcatgaaccagcatgaagcccttcaagtgtcaaaa
tggtggaaaggggaagctatgtcgaaggagccgacatttggaggatatgaagctttaaaa
tggtacatgtggcccatggcgtgcttcacagatccgagcttttcagagcagaggattgag
ctcacgaaatgcatctcgctagtatacctaattgatgacctttttgatgtttatggcacg
ttggatcagcttattctatttactgatgcggtcaagagatgggaattggtgggaacagag
cagcttccagaattcatgaaaatttgtctgcgtgctctttatgaaatcaccaacgatttc
gctgaaaaagtctacaaaatgcaaggattgaatcccatagatactgttaaaacttcgtgg
atacgactaacgaatgcgttcttggaagagagacattggttgaattttggtgaactgcca
aagacagaggaatacctgaagcatgcagttgtaagcacaggagtgcacgtggtgcttgtc
catgcatttttccttttccatcaaaatataacacacaaatctctagcaattttagacgac
tttccaaacattatatactccgtggccaaaatccttcgtcttagtgatgatttagaagga
tacaagaacaaaaatgaaacggggtttgatgggtcatacattgagtgctacatgagagaa
catcaagaggtttcagctgaagacgcacaaaagcatgttgaggagctgatttcaatggaa
tggaaacgtctcaatagacaagtaatgttgagcacagatcaccaattttcatcttcatat
accaaattctgcttgaatgctgctagaatggtccctctaatgtaccattaccgcaccaat
ccaagcctttccaacctgcatcaatatgtcaagtctattgccaaatgccaataa

DBGET integrated database retrieval system