KEGG   Actinoalloteichus hoggarensis: AHOG_15450
Entry
AHOG_15450        CDS       T04975                                 

Gene name
desVI
Definition
(GenBank) dTDP-3-amino-3,4, 6-trideoxy-alpha-D-glucopyranose
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg00523  Polyketide sugar unit biosynthesis
ahg01100  Metabolic pathways
ahg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ahg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    AHOG_15450 (desVI)
Enzymes [BR:ahg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     AHOG_15450 (desVI)
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_12 Ubie_methyltran CMAS
Other DBs
NCBI-ProteinID: ASO20716
UniProt: A0A221W4Y8
Position
3604049..3604759
AA seq 236 aa
MYEADLAAVYDAFYEARGKDYAAEAADIAREIRQRAPQASSLLDVACGTASHLRRFAALF
DDVEGMDLSEDMLAYARAKLPGVRLSRGDMRTVDLGREFDAITSMFSSVGYLRSTDELDE
TTHSLARHLTPGGVLVIEPWWFPETFLSGYVAGDVVTSGGRTIARVSHSVREGDATHMQV
HFIVADAESGAEHFTMSHVITLFTRQEYEQAFERAGLTVEYLPGGPSGRGLFIGVR
NT seq 711 nt   +upstreamnt  +downstreamnt
gtgtacgaagcagacctcgccgccgtctacgacgccttctatgaggcgcgcggcaaggac
tacgccgccgaggccgccgacatcgctcgggagatccgacagcgggcgccgcaggcgtcc
tcgctgctcgacgtcgcctgcgggaccgcgtcgcatctccgtcgcttcgccgccctcttc
gacgacgtcgaggggatggacctgtccgaggacatgctggcctacgcccgcgcgaagctg
ccgggggtgcggctgagccggggagacatgcgcaccgtcgacctcggccgcgagttcgac
gcgatcaccagcatgttcagctcggtcggttacctgcgttcgacggacgaactcgacgag
accacgcacagtctggcccggcacctgacgcctggcggcgtcctggtcatcgagccctgg
tggttccccgagacgttcctctccggctatgtcgccggcgacgtggtgaccagcggcggg
cggacgatcgcccgagtctcccactcggtgcgcgagggcgacgcgacgcacatgcaggtg
cacttcatcgtggccgacgccgagtccggtgccgagcacttcaccatgtcccacgtcatc
acgctgttcaccaggcaggagtacgagcaggccttcgaacgggcaggtctgaccgtcgaa
tacctgcccggcggcccgtccggccgagggctgttcatcggcgttcgctga

DBGET integrated database retrieval system