Agromyces intestinalis: FLP10_07875 Help Entry FLP10_07875       CDS       T09895                                  Name (GenBank) NUDIX domain-containing protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism ail  Agromyces intestinalis Brite KEGG Orthology (KO) [BR:ail00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ail03400]     FLP10_07875 Enzymes [BR:ail01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      FLP10_07875 DNA repair and recombination proteins [BR:ail03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     FLP10_07875  Prokaryotic type     FLP10_07875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_4 Motif Other DBs NCBI-ProteinID:  QEO14345 UniProt:  A0A5C1YFQ8 Position 1706800..1707204 Genome browser AA seq 134 aa AA seqDB search MPLPDLLVSAIALVRDRRVLMVTARGRDVHYMPGGKIDPGETAAEAASREAFEEVALELD PDQLHELFEVRTLAHGEPDGRHVRMRVFRAVTDASPRASAEVGALHWVTTADADRCPPAG REVLRLLAQADLID NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgcccctccccgacctgctcgtctccgcgatcgcgctcgtgcgcgaccgacgcgtgctg atggtcaccgcccgcgggcgcgacgtgcactacatgcccggcggcaagatcgaccccggc gagaccgccgcagaggccgcctcgcgcgaggcgttcgaggaggtcgcgctcgagctcgat cccgaccagctgcacgagctcttcgaagtgcgcacgctggcgcacggcgagcccgacggc cggcacgtgcgcatgcgggtcttccgggcggtgacggatgcctcgccgcgggcgtcggcc gaggtcggtgccctgcactgggtcacgacggccgatgccgaccgctgcccgcccgccggc cgcgaggtgctgcgcctgctggcccaggcggatctcatcgactga

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (2) Pfam (2) All databases (4) Download RDF

DBGET integrated database retrieval system