KEGG   Arachis ipaensis: 107622340
Entry
107622340         CDS       T04301                                 

Name
(RefSeq) (3S,6E)-nerolidol synthase 1
  KO
K24668  neryl diphosphate diphosphatase [EC:3.7.1.27]
Organism
aip  Arachis ipaensis
Brite
KEGG Orthology (KO) [BR:aip00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107622340
Enzymes [BR:aip01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.27  neryl diphosphate diphosphatase
     107622340
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 107622340
NCBI-ProteinID: XP_016179689
Position
B10
AA seq 542 aa
MYTNFVFPRCAGTAIGISSTFMDVLHAKQTVMLKEAKHVMKKLISEDPIMESLCMVDLIQ
RLGIEHHFQEHIEAALEKQHFIVTRDPIDFVQSHQLDKVALTFRLLRQGGYSVNADIFER
LKNNRVQFGEAYGEDLTSLIAVHEAAQLSIGEEDTSLEDVGRLCRELLHSWLSRHHHHHE
AQYVAISLQQPLHHNLPRFMDKTILLRNFKPDKKSVCFVELAEINSCIVRLMNQHEALQV
SKWWKGEAMSKEPKFAEYEALKWYMWSMACFTDPSFSDQRLELTKPISLVYIIDDIFDVY
GTLDQLILFTDAVKRWELTGTEHLPEFMKKCLSALYEITNAFSEKIYKKHGLNPINTLKK
SFLQLLNASLEGAHWSDSGELPNSEEYLKHATVSTGLHVMLVHSFFLFHQNITKETLAIL
DDFPDIIYSVAKILRLCDDLEGHKVKSKSVPLFFKMHHKKVIFNSITNHVEELISMEWKR
LNRQVLGRDQQFPSSFTKFCLSAARMVPLMYHYRTNPSLSNLHQHVKSIANAGVAHVNSL
VL
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgtataccaactttgtttttccaaggtgtgcaggcacagccataggcataagctccacc
ttcatggatgttttacatgcaaaacaaactgtgatgctgaaggaggctaagcatgtaatg
aagaaacttattagcgaggatccaataatggagagtttgtgcatggttgacttaatccaa
aggcttggcattgagcaccactttcaagagcacattgaagccgcacttgagaagcaacat
ttcatagtgaccagagatcccattgattttgtccaaagccatcaacttgacaaagttgca
ctcacgttccgtttactcagacaaggaggttattcagttaatgcagatatatttgagagg
ttgaaaaataacagagtgcagttcggagaagcatatggcgaagatttgacgagtctcata
gcggtacatgaagcagcgcagctaagcattggagaagaagatacttctcttgaggatgtg
gggcgcctctgccgcgagcttcttcattcatggctgtcaaggcatcatcatcatcatgaa
gctcaatatgttgcaatctctctccagcaaccacttcatcacaacttgcctagattcatg
gacaaaaccatcttgcttaggaatttcaagcccgacaaaaaatctgtgtgctttgtggaa
cttgcagaaatcaattcctgtatagttaggctcatgaaccagcatgaagcccttcaagtt
tcaaaatggtggaaaggggaagctatgtcgaaggagccgaaatttgcagagtatgaagct
ctaaaatggtacatgtggtccatggcatgcttcacagatccgagcttttcagaccaaagg
cttgagcttaccaaacctatctctctggtctacatcattgatgacattttcgatgtttat
ggcacgttggatcagcttattctatttactgatgcggttaagagatgggaattgaccgga
acagagcaccttcccgaattcatgaaaaagtgtttaagtgctctatatgaaattacaaat
gctttctccgaaaagatctacaaaaagcatggattgaatcctataaatacccttaaaaaa
tcgtttttgcaattgttgaatgcctccttggaaggggcacattggtctgattctggtgaa
ttgccaaattcagaggagtacttgaagcatgcaactgtaagcacaggactgcacgtgatg
cttgtccattcatttttccttttccatcaaaatataacaaaggaaactcttgcaatttta
gacgactttccagacattatatattccgtcgcaaaaatccttcgtctttgtgatgactta
gaaggacacaaggtaaaatccaagtctgttccattattctttaagatgcaccacaagaaa
gttatatttaattccattaccaatcatgttgaggagctgatttcaatggaatggaagcgt
ctcaatcgacaagtgttgggcagagatcagcaatttccatcgtcatttaccaaattctgc
ctgagtgctgctagaatggtccctctaatgtatcattaccgcaccaatccaagcctttcc
aacctacatcaacatgtcaagtctattgctaatgctggtgttgcacacgtaaattcactt
gtactataa

DBGET integrated database retrieval system