KEGG   Amycolatopsis japonica: AJAP_32100
Entry
AJAP_32100        CDS       T03225                                 
Name
(GenBank) glycosyl transferase family protein
  KO
K16440  chloroorienticin B synthase [EC:2.4.1.311]
Organism
aja  Amycolatopsis japonica
Pathway
aja01055  Biosynthesis of vancomycin group antibiotics
Brite
KEGG Orthology (KO) [BR:aja00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    AJAP_32100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:aja01008]
    AJAP_32100
Enzymes [BR:aja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.311  chloroorienticin B synthase
     AJAP_32100
Polyketide biosynthesis proteins [BR:aja01008]
 Nonribosomal peptide tailoring proteins
  Glycosyltransferase
   AJAP_32100
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_trans_4_4 Glyco_transf_4
Other DBs
NCBI-ProteinID: AIG79234
UniProt: A0A075V402
Position
complement(6843859..6845016)
AA seq 385 aa
MRVLLWACGSRGDVEPLVALAARLKESGAEVRVCAPPDSAERLAELDVPLVPVPRPDRGM
NDGEGRDPELAAAGIADQFDQMPAVAEGCDVVVATGLLSGAVAVRSVAEKLGIPYYYVAL
CPIHLPSHLEAPQREMYNQGADGLFGDALNAKRAEIGLAPVKNLFDYCSTEKPLLAADPI
LAPLEPRHEAVQTGAWILPDERPLPANLEAFLAAGAPPVYVGFGSSSGTADAAKVAIEAI
RAKGHRVILSRGWAGLDLPEDEADCFAVDEVNLQELFRRVAVSIHHDGTGTTHIATRAGS
PQIIVRSIVGQQYYSDRVAELGIGVALEGPAPSFEAMSAALTTALDPETRAKAIEVAETT
SADGTTVAVDLLRDAVSREKPSVPA
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgcgcgtgttgttgtgggcgtgtggatcacgcggcgacgtcgaaccgctggtcgcgttg
gcggcgcggttgaaggaatccggcgcggaagtgcgggtgtgcgcgccgccggacagcgcc
gaacggctggccgagctcgacgtgccgctggtgccggtcccccggccggaccgcgggatg
aacgacggcgagggacgggaccccgagctcgcggccgccgggatcgccgatcagttcgac
cagatgcccgccgtcgccgaaggctgcgacgtcgtggtggcgaccggtctgctgtccggc
gccgtcgcggtgcggtcggtggccgagaagctcggaatcccgtactactacgtcgctttg
tgcccgatccacctcccgagccacctcgaagcgccgcagcgggagatgtacaaccagggc
gccgacggcctgttcggcgacgcgctcaacgccaagcgtgccgagatcggcctggcgccg
gtgaagaacctcttcgactactgctccaccgaaaagcctttgctggcggcggatccgatc
ctcgcgccgctggagccgcggcatgaggccgtgcagaccggcgcgtggatcctgcccgac
gagcggccgcttcccgcgaacctggaggcgttcctcgccgccggagcgccgccggtgtac
gtcggtttcggcagttcgtccggcaccgccgacgcggcgaaggtggccatcgaggccatc
cgcgcgaagggccaccgtgtgatcctttcccgcggctgggccggtttggacctgcccgag
gacgaggccgactgcttcgccgtcgacgaggtgaacctgcaggagctgttccgccgggtc
gccgtctccatccaccacgacggcaccggcacgacccatatcgccacccgggcgggctcc
ccgcagatcatcgtgcggtcgatcgtcggccagcagtactactccgaccgggtcgccgag
ctggggatcggggtcgccctggaggggccggcgccgagcttcgaagccatgtccgccgcg
ctcaccacggcactggatcccgagacccgggccaaggcgatcgaggtcgccgagacgacc
agcgccgacgggaccacggtggccgtggacctgctgcgtgacgcggtcagccgcgaaaag
ccgtcggttcccgcctga

DBGET integrated database retrieval system