Acinetobacter johnsonii: RZ95_03470 Help Entry RZ95_03470        CDS       T04178                                  Name (GenBank) NUDIX hydrolase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism ajo  Acinetobacter johnsonii Brite KEGG Orthology (KO) [BR:ajo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ajo03400]     RZ95_03470 Enzymes [BR:ajo01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      RZ95_03470 DNA repair and recombination proteins [BR:ajo03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     RZ95_03470  Prokaryotic type     RZ95_03470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX Nudt16-like NUDIX_4 NUDIX_2 Motif Other DBs NCBI-ProteinID:  ALV72049 Position 690618..691022 Genome browser AA seq 134 aa AA seqDB search MAFQDFYRLSSHAVLTNAVGQVLLLKANYADQAWGLPGGALDMGETIHQALLRECQEELG CQVQIEYLSGVYFHAAVTSHAFIFRCHLAASAEIRLSDEHTAYAWFDLDQLSKVQRIRVE DCLNYTGIVQSRSF NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atggcatttcaagacttttaccgactgagttctcatgcggtgctaaccaatgctgtaggg caggttttattactgaaagccaattatgccgatcaggcttgggggctgccaggtggagcc ttggatatgggagaaaccattcatcaggctttgctgcgtgagtgccaagaagaactcggt tgtcaggttcagatagagtatttgtcgggtgtgtactttcatgcggcagtgacctcgcat gcctttatttttagatgccatctggctgcatctgctgagatcaggctcagtgatgaacat acggcctatgcttggtttgatctagatcagctgtcgaaagtacaacggattcgcgttgaa gattgtttaaattatacaggtatcgtgcaaagccgaagtttttga

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (4) Pfam (4) All databases (6) Download RDF

DBGET integrated database retrieval system