KEGG   Acidovorax sp. JS42: Ajs_0595
Entry
Ajs_0595          CDS       T00455                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00071  Fatty acid degradation
ajs00280  Valine, leucine and isoleucine degradation
ajs00281  Geraniol degradation
ajs00362  Benzoate degradation
ajs00592  alpha-Linolenic acid metabolism
ajs00642  Ethylbenzene degradation
ajs01100  Metabolic pathways
ajs01110  Biosynthesis of secondary metabolites
ajs01120  Microbial metabolism in diverse environments
ajs01212  Fatty acid metabolism
Module
ajs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Ajs_0595
   00592 alpha-Linolenic acid metabolism
    Ajs_0595
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ajs_0595
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Ajs_0595
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ajs_0595
   00642 Ethylbenzene degradation
    Ajs_0595
Enzymes [BR:ajs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     Ajs_0595
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Other DBs
NCBI-ProteinID: ABM40842
UniProt: A1W3L7
Position
628688..629884
AA seq 398 aa
MKQIQDAYIVAATRTPIGRSHKGFFRNYRPDDLLATTLKSALAQVPGLDPASIEDIICGC
AIPEAQQGLNVARIGAVLAGLPTSVGGITVNRFCASGLSAVAMAADRIRVGEAEVMIAAG
VESMSMVPMMGNAPSLSPSIFERDGDVGIAYGMGLTAEKVAQQWKVSREAQDAFALESHR
RAIAAQQAGEFADEITPIEVTDRTANLETGEVIASTRTVSLDEGARPDTSLEGLAKLRTV
FAARGTVTAGNSSQTSDGAGALILASESAVKRFGLTPLARFVSFASKGVPPSIMGIGPIE
AIPAALRYAGLKQDDIGWYELNEAFAAQSLAVINTLGLDTAKVNPMGGAIALGHPLGATG
AIRSATVVHALRRKQLKYGMVTMCVGMGQGAAGIFERV
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgaaacagatccaagacgcctacatcgttgccgccacgcgcacgcccatcggccgttcg
cacaagggctttttccgcaactaccgcccggacgacctgctggccaccacgctcaagagc
gcgctggcccaggtgccggggctggaccccgcctcgatcgaggacatcatctgcggctgc
gccatccctgaggcgcagcagggcctgaacgtggcgcgcatcggtgccgtgctggcgggc
ctgcccaccagcgtgggcggcatcacggtgaaccgcttctgcgcttcgggcctgtcggcc
gtggccatggcggccgaccgcatccgcgtgggcgaggccgaggtgatgatcgccgccggc
gtggagagcatgagcatggtgcccatgatgggcaacgcgcccagcctgtcgcccagcatc
ttcgagcgtgacggcgacgtgggcatcgcctacggcatgggcctcaccgccgagaaggtg
gcccagcagtggaaggtgagccgcgaggcgcaggacgccttcgcactggagtcgcaccgc
cgcgccatcgccgcgcagcaggccggcgagtttgccgacgagatcacgcccatcgaggtg
accgaccgcacggccaacctggagacgggcgaagtcattgccagcacccgcaccgtgagc
ctggacgagggcgcccgccccgacaccagcctggaaggcctggccaagctgcgcaccgtg
ttcgccgcgcgcggcacggtcacggctggcaacagctcgcagaccagcgacggcgccggc
gcgctgatcctggccagcgaatccgccgtcaagcgcttcggcctcacgccgctggcgcgc
ttcgtcagcttcgccagcaagggcgtgccgccgtccatcatgggcatcggtccgatcgag
gccattcccgccgcgctgcgctatgccggtctgaagcaggacgacatcggctggtacgag
ctcaacgaagccttcgccgcccagtcgctggccgtcatcaacacgctggggctggacacg
gccaaggtcaaccccatgggcggcgccatcgcgctgggccacccgctgggcgcgacgggc
gccatccgctcggccaccgtggtgcatgcgctgcgccgcaagcagctcaagtacggcatg
gtcaccatgtgcgtgggcatgggccagggcgcggcgggtatcttcgagcgcgtgtaa

KEGG   Acidovorax sp. JS42: Ajs_3548
Entry
Ajs_3548          CDS       T00455                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00071  Fatty acid degradation
ajs00280  Valine, leucine and isoleucine degradation
ajs00281  Geraniol degradation
ajs00362  Benzoate degradation
ajs00592  alpha-Linolenic acid metabolism
ajs00642  Ethylbenzene degradation
ajs01100  Metabolic pathways
ajs01110  Biosynthesis of secondary metabolites
ajs01120  Microbial metabolism in diverse environments
ajs01212  Fatty acid metabolism
Module
ajs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Ajs_3548
   00592 alpha-Linolenic acid metabolism
    Ajs_3548
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ajs_3548
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Ajs_3548
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ajs_3548
   00642 Ethylbenzene degradation
    Ajs_3548
Enzymes [BR:ajs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     Ajs_3548
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-ProteinID: ABM43661
UniProt: A1WBN6
Position
complement(3738668..3739879)
AA seq 403 aa
MSNARHAFICDAIRTPFGRYGGALSSVRTDDLGALPIKALMERNPGVDWAAVDDVLYGNA
NQAGEDNRNVARMSSLLAGLPIDVPGATINRLCGSGLDAVGSAARAIKSGEARLMIAGGV
ESMSRAPFVMPKAESAFSRSNAVYDTTIGWRFINKLMKAQYGVDSMPETAENVADDFKIE
REAQDRMALASQQKAAAAMAAGYLAKEIVNVVIPQKKGDAVVVSQDEHPRATTLEALAKL
KGVVREGGTVTAGNASGVNDGACALLLADEAAAQQYNLVPRARVVGMAVAGVAPRIMGFG
PAPAVRKVLAQTGLTLDQMDVIELNEAFAAQGLAVLRDLGVADDDKRVNQWGGAIALGHP
LGASGARLATTAVNQLHTLGGRYALCTMCIGVGQGIAVVLERV
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgagcaacgcccgccacgccttcatctgcgacgcgatccgcacccccttcggccgctac
ggcggcgccctctccagcgtgcgcaccgacgacctgggcgcgttgcccatcaaggcgctg
atggagcgcaaccccggcgtggactgggccgcggtggatgacgtgctgtatggcaacgcc
aaccaggccggcgaggacaaccgcaacgtggcgcgcatgtccagcctgctggccggcctg
cccatcgacgtgcccggcgccaccatcaaccgcctgtgcggctcgggcctggacgccgtg
ggctccgccgcgcgcgccatcaagtcgggcgaggcgcgcttgatgatcgccggcggcgtc
gagtccatgagccgcgcgcccttcgtgatgcccaaggcggaaagcgccttcagccgcagc
aacgcggtgtacgacaccaccatcggctggcgcttcatcaacaagctgatgaaggctcaa
tacggcgtggactccatgcccgagacggccgagaacgtggccgacgatttcaagatcgag
cgcgaggcccaggaccgcatggcactggccagccaacagaaggcggccgccgcgatggcc
gccggctacctggccaaggaaatcgtcaacgtcgtcattccccagaagaagggcgacgcc
gtcgtggtcagccaggacgagcatccgcgcgccaccacgctggaggcgctggccaagctc
aagggcgtggtgcgcgagggcggcaccgtcacggccggcaacgccagcggcgtgaacgac
ggcgcctgcgcgctgctgctggccgatgaggcggccgcccagcaatacaacctggtgccc
cgcgcccgcgtggtgggcatggccgtggccggcgtggcgccgcgcatcatgggctttggc
cccgcgcctgccgtgcgcaaggtgctggcccagaccggcctgacgctggaccagatggac
gtgatcgagctgaacgaagctttcgccgcacagggcctggccgtgctgcgcgacctgggt
gttgccgatgacgacaagcgcgtcaaccagtggggcggcgccatcgccctgggccacccg
ctgggggcctcgggcgcgcgcctggccaccaccgccgtgaaccagctgcacacgctgggc
ggccgctacgcactgtgcaccatgtgcatcggcgtgggccagggcatcgccgtggtgctg
gagcgcgtgtaa

DBGET integrated database retrieval system