KEGG   Acidovorax sp. JS42: Ajs_2098
Entry
Ajs_2098          CDS       T00455                                 

Name
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K19961  6-hydroxyhexanoate dehydrogenase [EC:1.1.1.258]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00930  Caprolactam degradation
ajs01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Ajs_2098
Enzymes [BR:ajs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.258  6-hydroxyhexanoate dehydrogenase
     Ajs_2098
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N ThiF
Other DBs
NCBI-ProteinID: ABM42273
UniProt: A1W7P8
Position
complement(2219061..2220113)
AA seq 350 aa
MRCYCVMHHSKPLELVERETPQPVGTEVLVRVKAAGLCHTDLHIWEGFYDLGGGKRMNLA
DRGIKPPLILSHEICGEVVAAGPDAGEVPTGSRYVIHPWIGCGECPTCLRGDENLCLKGR
ALGVARPGGFADYVIVPHPRYLVNIDGLDDAEAAPLACAGVTTYSAIKKLGEGIHREPVV
MIGAGGLGLMAIEVLKALGGKGAIVVDIDPAKREAALAAGALAVIDGKAADATSQIIAAT
EGGAGQILDLVGSSATVSLAMQSARRGGHIVICGLMGGDLTISLATIPLRPLCIEGSYVG
TLAELRELVELVKRTGMKSIPVSRRPMAQVNQAIDDLHHGKVIGRAVLIP
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgcgctgttattgcgtgatgcaccattcaaagccgcttgaactcgtcgagcgtgagact
ccgcagcccgtgggaaccgaggtgctcgtgcgtgtgaaggccgccggcctttgccacacc
gacctgcacatctgggaaggtttttacgacctgggcggcggcaagcgcatgaacctggca
gaccggggcatcaagccgcccctcatcctcagccacgaaatctgtggcgaggtggtggca
gccggaccggatgccggcgaagtcccgaccggctcccgctacgtcatccacccctggatc
ggctgcggcgaatgccccacctgcctgcgcggcgatgaaaacctgtgcctgaagggccgc
gcccttggcgtggcacgccccggtggctttgccgattacgtgatcgttccccacccgcgc
tacctggtcaacatcgacggtctggacgatgccgaggcggcgcctctggcctgcgcgggc
gtgacgacctacagcgccatcaagaaactgggcgaaggcatccaccgcgaacccgtcgtc
atgattggtgccggaggcctgggcctgatggccatcgaggtgctgaaggcccttggcggc
aaaggcgcgatcgtggtggacatcgaccctgccaagcgcgaagccgcgctggcagccggc
gcgctggcagtgatcgacggcaaggctgccgatgcgaccagccagatcatcgcggcgact
gaaggcggtgccggccagattctggacctggtgggctcgtccgccaccgtatcgctggcc
atgcagagcgcccggcgcggcggccacatcgtcatctgcgggctgatgggcggtgatctg
accatctccctggcgaccatcccgctgcgcccgctgtgcatcgagggcagctacgtcggc
accctggccgaactgcgagagctggtggagctggtcaagcgcaccggcatgaagtcgatt
ccggtgtcgcgccgccccatggcccaggtgaaccaggccatcgacgacctgcaccacggc
aaggtgatcgggcgcgcagtcctgatcccataa

DBGET integrated database retrieval system