KEGG   Alteromonas naphthalenivorans: ambt_17880
Entry
ambt_17880        CDS       T01513                                 

Definition
(GenBank) DSBA oxidoreductase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00626  Naphthalene degradation
alt01100  Metabolic pathways
alt01120  Microbial metabolism in diverse environments
alt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:alt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    ambt_17880
Enzymes [BR:alt01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     ambt_17880
SSDB
Motif
Pfam: DSBA
Other DBs
NCBI-ProteinID: AEF05075
UniProt: F5Z5S0
Position
complement(4005977..4006591)
AA seq 204 aa
MNINFFFDFLSPFSYLASVKLAKLSDDTIHNICYHAIDLARAKKAIGNIGPTNRDMPVKL
SYLKKDIDRWAELYDIPLKFIPNFNSEKLNIGMFYTADKDIQAEYVNLAFFLTWGKGNAP
DSPLVFDEICKTLNWEIKEFTHFIESDIGIKAYQKSTENAIKKHIFGVPTMMIDENMWWG
NDRIIFLEKFLNTNNKQINRRESK
NT seq 615 nt   +upstreamnt  +downstreamnt
ttgaatataaatttcttttttgattttttaagccctttttcatatttagctagcgtaaaa
cttgcaaagctaagtgacgatacaattcataatatatgctatcacgctattgatttagca
cgtgcaaaaaaagcaatcggaaatatcggacctacaaatcgagatatgccagtaaagcta
tcttacctaaagaaagatatagatcggtgggcagagctgtatgatatcccattaaaattt
atacctaattttaattcagaaaaattaaatataggtatgttttatactgcggataaagat
atccaagcagaatatgtcaatcttgcattttttttaacatggggaaaaggaaatgcacct
gatagcccattagtttttgatgaaatttgtaaaacactgaattgggagataaaagaattc
acccattttattgaatcagatataggcataaaagcctaccagaaatctactgaaaacgcg
attaagaaacatatctttggtgtcccaactatgatgattgatgagaatatgtggtgggga
aatgaccgtattatatttttagaaaaatttttaaatacaaataataaacaaataaacaga
agggaaagcaaatga

DBGET integrated database retrieval system