KEGG   Arabidopsis lyrata (lyrate rockcress): 9309297
Entry
9309297           CDS       T01578                                 

Name
(RefSeq) UDP-glycosyltransferase 76C2
  KO
K13493  cytokinin-N-glucosyltransferase [EC:2.4.1.-]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00908  Zeatin biosynthesis
aly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00908 Zeatin biosynthesis
    9309297
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aly01003]
    9309297
Enzymes [BR:aly01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     9309297
Glycosyltransferases [BR:aly01003]
 Others
  Hydrophobic molecule
   9309297
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 9309297
NCBI-ProteinID: XP_020875974
Position
Unknown
AA seq 454 aa
MEEKRNGLRVILFPLPLQGCINPMIQLANILHSRGFSITVIHTRFNAPKASSHPLFTFLQ
ISDGLSETQTKDGPSPNVMSLLAQININAESPFRDCLRELLLESKESERVSCLIDDCGWL
FTQTVAESLNLPRLVLCTFKATFFNAYPSLPLIRTKGYLPVSDSEAEDSVPEFPPLQKRD
LSKVFGEFGEKLDPFLHAVVETTMSSSGLIFMSCEELEKDSLTIANEIFEVPIFAIGPFH
SYFSASSSSLFTQDETCIPWLGNQKDKSVIYVSLGSVVNITETEFLEIACGLSNSKQSFL
WVVRPGSVLGAKWIEPLSEGLVRSLEEKGKIVKWAPQQEVLAHRAIGGFLTHNGWNSTLE
SICEGVPMICLPGGWDQMLNSRFVSDIWKVGIHLEGRIEQKEIEKAVRMLMEENEGEKIR
ERMKVLKDEVEKSVKLGGSSFQSIETLANHILLL
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggaggagaagagaaatggtctgcgagtgattctcttccctcttccattacaaggttgc
ataaaccctatgattcagcttgccaacatccttcactcgagaggtttctccattaccgtg
atccacacgcgcttcaacgcgccaaaagcttcaagccatcctctcttcactttcttacag
atttctgatggcttgtctgaaactcagactaaagatggtccttctccgaatgttatgtct
ttgcttgcacaaatcaacattaacgctgagtctccgtttcgtgattgcttgcgtgaactg
ttgcttgaatcgaaagaatcagagagggttagttgtttgatcgatgattgtggatggctc
ttcacacaaactgttgcagagagtttgaatcttccaaggcttgttctctgtacttttaaa
gccactttcttcaatgcttatccgagtcttccacttatccggaccaaaggctatcttcca
gtttcagattcggaagcagaggactctgttcctgagttcccgccgcttcaaaagagagat
ctttcaaaggttttcggggaattcggagagaaacttgatccgttcttacatgctgtagtc
gaaacgacaatgagctcttcagggctaatattcatgtcctgcgaagagcttgagaaagat
tcgttgactattgctaacgaaattttcgaagttcccatctttgcgattggtccgtttcac
agctacttctctgcttcatcaagcagcttattcacacaggacgagacttgcattccttgg
ttaggtaatcaaaaggacaaatccgttatctacgtgagtctaggaagcgttgtgaatatt
acggaaacagagttcttggagattgcttgtggtttaagcaatagcaaacagtctttcttg
tgggtagtacgacccggttcagtactcggcgcgaaatggatcgaaccgctctctgaaggg
ctcgttagaagccttgaagagaaaggaaagattgtgaaatgggcaccccaacaagaggtt
cttgcgcatcgagccattggagggtttttgacgcataatggatggaactcaacgctagag
agtatatgcgaaggggttcctatgatctgcttaccaggaggttgggatcaaatgctgaat
tcaagatttgtgagcgatatttggaaggtcggaattcatttggaaggtcggattgaacaa
aaggagattgagaaagctgtgaggatgttaatggaggaaaatgaaggagaaaagattcgt
gagaggatgaaagtcttgaaagatgaggtcgagaaatcggttaaacttggtggctcatct
tttcaatctattgagactctggctaatcatatattattgttgtaa

DBGET integrated database retrieval system