KEGG   Arabidopsis lyrata (lyrate rockcress): 9314717
Entry
9314717           CDS       T01578                                 

Name
(RefSeq) serine carboxypeptidase-like 8
  KO
K09757  serine carboxypeptidase-like 8 [EC:3.4.16.- 2.3.1.92]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00940  Phenylpropanoid biosynthesis
aly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    9314717
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aly01002]
    9314717
Enzymes [BR:aly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.92  sinapoylglucose---malate O-sinapoyltransferase
     9314717
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.-  
     9314717
Peptidases and inhibitors [BR:aly01002]
 Serine peptidases
  Family S10
   9314717
SSDB
Motif
Pfam: Peptidase_S10 UCR_hinge
Other DBs
NCBI-GeneID: 9314717
NCBI-ProteinID: XP_020884047
Position
Unknown
AA seq 435 aa
MRLKIKFLLLLLLVFCHHVYCASIVKFLPGFEGPLPFELETGYIGIGEDENVQFFYYFIK
SENNPKEDPLLIWLNGGPGCSCLGGILFENGPVGLKFEVYNGSAPSLFSTTYSWTKMANI
IFLDQPVGSGFSYSKTPIDKTGDISEVKRTHEFLQKWLRRHPQYFINPFYVVGDSYSGMI
VPALVQEISQGNYICCEPPINLQGYMLGNPVTYMDFEQNFRILYAYGMGLISDEIYEPMK
RSCNGNYYNVDPSNTKCLKLTEEYHKCTDKINIHHILTPDCDVTNVTSPDCYYYPYHLIE
CWANDESVREALQIKKGSKGKWARCNRTIPYNHDIESSIPYHMNNSIRGYRSLIYSGDHD
IAVPFLATQAWIRSLNYSPIHNWRPWMINNQIAGYTRAYSNKMTFATIKGGGHTAEYRPN
ETFIMFQRWISGQLL
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgagattgaaaataaagtttctgcttctgcttctacttgtcttctgtcatcatgtttat
tgtgcctctattgtcaagtttcttcctggttttgaaggccctcttcctttcgaacttgaa
accgggtacattggtattggtgaggacgagaatgtgcaatttttctactatttcattaaa
tctgagaacaatccaaaagaagatcctcttcttatatggttaaatggaggacctggatgt
tcttgtctcggtggtattctttttgagaacggaccggtgggtttgaagttcgaggtgtac
aatggaagtgctccttctttgttctctactacatattcatggacaaagatggcaaacata
atattcttggatcagccagtaggatctggcttctcctactcaaaaactccaattgataaa
actggtgacataagtgaagtaaagaggacccatgagtttcttcaaaagtggctaaggagg
catccacaatacttcatcaatcctttttatgttgtcggagattcttattccggtatgatt
gtccctgccctcgttcaagaaatctcacaaggaaactatatatgttgcgaacctcctata
aatctacagggttatatgcttggaaaccctgtaacatatatggactttgaacaaaacttc
cgcattctatatgcttatggcatgggtttaatctccgatgagatctatgagccaatgaag
agaagctgcaatggaaattattacaatgtggatccatctaacacaaaatgtttgaaactt
actgaagaataccataagtgcactgacaaaataaatatccatcatatattaacaccagat
tgcgatgtaaccaatgtaacatctcctgattgttattactatccgtatcatctcattgaa
tgttgggccaacgatgagagcgttcgtgaagctcttcaaattaaaaaggggagtaaagga
aaatgggcgcgatgtaatcggactattccatacaatcacgacatcgaaagcagcatacca
tatcacatgaataacagcataagaggataccgatctcttatttatagtggtgatcatgac
attgcggtcccttttcttgcaactcaagcgtggataagatctctcaattactcccccatt
cataactggaggccttggatgataaacaatcaaattgctggatacacgagagcttattcc
aataagatgacatttgctactatcaaaggaggtggacacacggcagagtatagaccaaac
gagacctttatcatgttccaaaggtggatcagtggccaacttctgtaa

DBGET integrated database retrieval system