KEGG   Amycolatopsis mediterranei U32: AMED_0650
Entry
AMED_0650         CDS       T01269                                 

Name
(GenBank) methyltransferase type 11
  KO
K15467  27-O-demethylrifamycin SV methyltransferase [EC:2.1.1.315]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd01051  Biosynthesis of ansamycins
amd01052  Type I polyketide structures
amd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    AMED_0650
   01051 Biosynthesis of ansamycins
    AMED_0650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:amd01008]
    AMED_0650
Enzymes [BR:amd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.315  27-O-demethylrifamycin SV methyltransferase
     AMED_0650
Polyketide biosynthesis proteins [BR:amd01008]
 Polyketide tailoring proteins
  Methylase
   AMED_0650
SSDB
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 CMAS Methyltransf_23 Methyltransf_12 Ubie_methyltran Methyltransf_9 MTS MetW PCMT Methyltransf_4 CheR Methyltransf_32 UPF0020 Methyltransf_8 DREV PrmA GidB Methyltransf_15 Methyltransf_29 Methyltransf_18
Other DBs
NCBI-ProteinID: ADJ42470
UniProt: A0A0H3CWN7
Position
710432..711250
AA seq 272 aa
MTKPTPNEIGKGYDAFADLLDQLWGENLHHGYWDDESATLEEATTRLTDRLAGMLPLRAG
DRLLDIGCGNGEPAIRMATANDVMVTGISISEKQVERANDRAYKADVDDRVVFEYADAME
LPYPDASFDVVWALESLHHMPDRWHVIRQAARVLRPGGRLALGDFLLVPSPAGLEADAER
VREVGKGVVAVVSLDEYQAHLREAGLEPESAEDVSQYTRPSWTKAAERFEGLREQALQHI
EAAQFEVTLGRFRAFSEEPSLGYVLLTARKPD
NT seq 819 nt   +upstreamnt  +downstreamnt
gtgacgaagccgactccgaacgagattggtaagggctacgacgctttcgcggacctgctc
gaccagctctggggtgaaaacctgcaccacggatactgggacgacgagtccgcgacgctc
gaagaggccaccacgcggctgaccgaccggctggccgggatgctcccgctgcgcgccggc
gaccggctgctcgacatcggctgcggcaacggcgaaccggcgatccggatggccaccgcg
aacgacgtcatggtcaccggcatctcgatcagcgagaagcaggtggaacgggcgaacgac
cgcgcgtacaaggccgacgtggacgaccgggtcgtcttcgagtacgccgacgcgatggag
ctgccgtacccggacgcgtcgttcgacgtcgtctgggcgctggagtccctgcaccacatg
ccggaccgctggcacgtgatccgccaggcggcccgggtgctgcggccgggcggccgcctg
gcgctcggcgacttcctgctcgtgccgagcccggccggcctcgaggccgacgccgagcgc
gtgcgcgaggtgggcaagggcgtggtggcggtcgtctcgctcgacgagtaccaggcgcac
ctgcgcgaggccgggctggagcccgaatccgccgaggacgtcagccagtacacccggccg
tcgtggaccaaggcggcggagcggttcgaaggactgcgggaacaggccctgcagcacatc
gaggccgcgcagttcgaggtcaccctcggccggttccgcgcgttcagcgaggaaccgtcg
ctggggtacgtcctgctgaccgcgcgcaagcccgactga

DBGET integrated database retrieval system