KEGG   Actinosynnema mirum: Amir_4362
Entry
Amir_4362         CDS       T00957                                 

Definition
(GenBank) Methyltransferase type 11
  KO
K13330  dTDP-4-amino-2,3,4,6-tetradeoxy-D-glucose N,N-dimethyltransferase [EC:2.1.1.324]
Organism
ami  Actinosynnema mirum
Pathway
ami00523  Polyketide sugar unit biosynthesis
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ami00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Amir_4362
Enzymes [BR:ami01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.324  dTDP-4-amino-2,3,4,6-tetradeoxy-D-glucose N,N-dimethyltransferase
     Amir_4362
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 MetW
Other DBs
NCBI-ProteinID: ACU38213
UniProt: C6WK00
Position
5155490..5156230
AA seq 246 aa
MTEALDRAVPAQGREHAEIYEVVHSARGRDWVAEADLVAKLVLARNPWAGSLLDVACGTG
AHLRRFGSRFARVAGVELSPAMRGIAEARLPGVPVHAGDVRGFDLGVRFDAVTCLRFAIA
HARSLAELGTVAECFARHLVHGGVLVVEPWWFPERFPEGCVSGSVVERDGVVVSRLSHSV
RRGRTTSTTVRYTVAEASGIRDFTEREELGLFGEEEYLAAFAAAGISAAHVPGGLNGRGV
FVGVRC
NT seq 741 nt   +upstreamnt  +downstreamnt
gtgaccgaggcgcttgaccgggcggtgcccgcccagggccgggagcacgcggagatctac
gaggtggtgcactccgcgcgcgggcgggactgggtcgcggaggccgacctggtcgccaag
ctggtgctcgcgcgcaacccgtgggccgggtcgctgctggacgtcgcctgcgggacgggg
gcgcacctgcggcggttcgggtcgcggttcgccagggtggccggggtggagctgtcgccc
gccatgcgcgggatcgccgaggcgcggctgccgggggttccggtgcacgccggggacgtg
cgcgggttcgacctcggggtgcggttcgacgcggtgacgtgcctgcgcttcgccatcgcc
cacgcccggtcgctcgcggagctggggacggtcgcggagtgcttcgcccggcacctggtg
cacggcggggtgctggtggtggagccgtggtggttccccgagcggttcccggaggggtgc
gtgagcgggtcggtggtcgagcgggacggggtggtggtgagccggctgtcgcactcggtg
cggcgggggcggacgaccagcacgacggtgcggtacacggtggcggaggcgagcgggatc
cgggacttcaccgagcgggaggagctggggctgttcggggaggaggagtacctggcggct
ttcgcggcggcggggatcagcgcggcgcacgtgcctggcgggttgaacgggcggggggtg
ttcgtgggggtgcggtgctga

DBGET integrated database retrieval system