Amycolatopsis mongoliensis: QRX60_19265 Help Entry QRX60_19265       CDS       T09938                                  Name (GenBank) NUDIX domain-containing protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism amog  Amycolatopsis mongoliensis Brite KEGG Orthology (KO) [BR:amog00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:amog03400]     QRX60_19265 Enzymes [BR:amog01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      QRX60_19265 DNA repair and recombination proteins [BR:amog03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     QRX60_19265  Prokaryotic type     QRX60_19265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_4 Motif Other DBs NCBI-ProteinID:  WIY05875 UniProt:  A0A9Y2JXP4 Position 3942659..3943057 Genome browser AA seq 132 aa AA seqDB search MNGVIVGAALVRDGKLLAQQRAWPPGHAGQWELPGGRVEEGESEAFALARECSEELDVVI EVGARVGEDVPLPGDKVLRIYAAKLVSPGEEPRAVEHLAVRWLGPDDLDDVDWLPADRLL LPAFRDLLDQEP NT seq 399 nt NT seq  +upstreamnt  +downstreamnt gtgaacggtgtgatcgtgggtgccgccctcgtgcgcgacggcaagttgctcgcccagcag cgggcctggccgccggggcacgcggggcagtgggagctgccgggagggcgggtcgaggaa ggcgagtccgaggccttcgccctggcccgcgagtgcagcgaagagctcgacgtcgtcatc gaggtcggggcgcgcgtcggggaagacgtcccgctgcccggcgacaaggtcctgcgcatc tacgccgcgaagctcgtttcgcccggtgaagaaccgcgcgcggtggagcacctcgcggtc cgatggctcgggcccgacgacctcgacgacgtcgactggctgcccgccgaccgcctgctg ctgcccgccttccgcgacctcctcgaccaagagccgtga

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (2) Pfam (2) All databases (4) Download RDF

DBGET integrated database retrieval system