KEGG   Actinoplanes missouriensis: AMIS_50600
Entry
AMIS_50600        CDS       T01795                                 

Definition
(GenBank) putative methyltransferase
  KO
K13326  dTDP-3-amino-2,3,6-trideoxy-4-keto-D-glucose/dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.- 2.1.1.234]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00523  Polyketide sugar unit biosynthesis
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
Module
ams_M00800  dTDP-L-megosamine biosynthesis
Brite
KEGG Orthology (KO) [BR:ams00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    AMIS_50600
Enzymes [BR:ams01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     AMIS_50600
    2.1.1.-  
     AMIS_50600
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_12 NodS CMAS Ubie_methyltran MetW Methyltransf_15 Methyltransf_2
Other DBs
NCBI-ProteinID: BAL90280
UniProt: I0HB93
Position
5362933..5363742
AA seq 269 aa
MTTIGVPTTATKGAAMPATTDQTSTDTHTDTDTGIYQRADVYHDFYHARGKDYRAEADAV
RALIAGHAPGATSLLDVACGTGSHLRELAASFGEVVGVDLSAEMLAVAARHAPGVELHRG
DMRDFRLDRTFDAVICMFSSIGYVCGRTELDRAVTNLAAHVAPDGVLIIEPWWFPDTFRD
GWVGADVVTAGERRISRVSHTVRRGGTSRMDVHYVVAASGAGIEHFTDTHVMSLFDRADY
ERAFHAAGFRADYLRPDAAGPGLFAGVRR
NT seq 810 nt   +upstreamnt  +downstreamnt
gtgacaaccatcggcgtacccaccaccgcgacgaagggagccgccatgccggccaccacc
gaccagaccagcaccgacactcacaccgacaccgacaccgggatctaccagcgcgccgac
gtctaccacgacttctaccacgcccggggcaaggactaccgcgccgaggccgacgcggtc
cgcgccctgatcgccggccacgcgccgggcgccacctccctgctcgacgtggcctgcggc
accggctcgcacctgcgggagctggcggcgtccttcggcgaggtcgtcggcgtcgacctg
tcggccgagatgctggcggtcgcggcgcggcacgcgcccggcgtcgagctgcaccgcggc
gacatgcgcgacttccggctggaccgcacgttcgacgcggtgatctgcatgttcagctcc
atcgggtacgtgtgcggccgcaccgaactggaccgagccgtcacgaacctggccgcccac
gtggcgccggacggtgtgctgatcatcgagccgtggtggttcccggacaccttccgggac
ggctgggtcggcgcggacgtcgtcaccgccggcgagcgccggatctcccgggtctcgcac
acggtgcgccggggcggcaccagccggatggacgtccactacgtcgtcgccgcttccggc
gccggtatcgagcacttcaccgacacccatgtgatgtcgctcttcgaccgggccgactac
gaacgggcgttccacgccgccgggttccgggccgactacctgcggccggacgccgccgga
ccgggcctgttcgccggggtccggcgatga

DBGET integrated database retrieval system