KEGG   Amycolatopsis sp. BJA-103: BKN51_41460
Entry
BKN51_41460       CDS       T05296                                 
Name
(GenBank) glycosyl transferase
  KO
K16440  chloroorienticin B synthase [EC:2.4.1.311]
Organism
amyb  Amycolatopsis sp. BJA-103
Pathway
amyb01055  Biosynthesis of vancomycin group antibiotics
Brite
KEGG Orthology (KO) [BR:amyb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    BKN51_41460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:amyb01008]
    BKN51_41460
Enzymes [BR:amyb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.311  chloroorienticin B synthase
     BKN51_41460
Polyketide biosynthesis proteins [BR:amyb01008]
 Nonribosomal peptide tailoring proteins
  Glycosyltransferase
   BKN51_41460
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_trans_4_4 Glyco_transf_4
Other DBs
NCBI-ProteinID: AUI63985
UniProt: A0A2N8MPK4
Position
9298207..9299364
AA seq 385 aa
MRVLLWACGSRGDVEPLVALAARLRESGAEVRMCAPPDSAERLAEIGVPLVPVARPDRGM
NDGEGRDPALAAAGIAEQFDQMPSVAEGCDVVVATGLLSGAVAVRSVAEKLGIPYHYVAL
CPIHLPSHLEAAQRVMYNQGADGLFGDALNAKRAEIGLPPAKNLFDYCSTDKPLLAADPI
LAPLEPRHEAVQTGAWILPDERPLSAELEAFLAAGPPPVYVGFGSSSGTADAAKVAIEAS
RAQGHRVILSRGWADLDLPDAGADCFAVDEVNLQELFRRVALTIHHDGTGTTHVATRGGA
PQIVVRSIVGQQYYSDRIAELGIGVALEGPAPSFEAMSAALTTALSPESRERAIAVADTI
REDGTTAAVELLREAVSREKPSVPA
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgcgcgtgttgttgtgggcgtgtggatcacgaggggacgtcgagccgctggtggcgctg
gcggcgcggctgcgggaatccggcgccgaggtgcggatgtgcgcgccgccggacagcgcg
gagcggctggccgagatcggggttccgctggtgccggtcgcgcgcccggaccgggggatg
aacgacggcgagggacgcgatcccgccctcgcggcggccgggatcgccgagcagttcgac
cagatgccgtcggtcgccgaaggctgcgacgtcgtggtggcgaccggtctgctgtccggt
gcggttgccgtgcgctcggtcgccgagaagctcgggattccttaccactacgtcgctttg
tgcccgatccacctgccgagccacctcgaagcggcgcagcgggtgatgtacaaccagggt
gccgacgggctgttcggtgacgcgctcaatgccaagcgggccgagatcggcctgccgccg
gcgaagaacctcttcgactactgctccaccgacaagcctttgctggccgcggatcccatc
ctcgccccgctcgaaccgcggcacgaggccgtgcagaccggcgcgtggatcctgcccgac
gaacgcccgctttccgctgagctggaggcgttcctcgccgccgggccgccgccggtgtac
gtcggtttcggcagctcgtccgggaccgccgacgcggcgaaggtcgccatcgaggcgagc
cgtgcccaggggcatcgggtgatcctttcgcgcggctgggccgatctcgacctgcccgac
gcgggcgccgactgtttcgccgtcgacgaggtgaacctccaggagttgttccgccgggtc
gccctcaccatccaccacgacggcacggggacgacgcacgtggccacccgcgggggcgct
ccccagatcgtggtgcgctcgatcgtcggccagcagtactactcggaccggatcgccgaa
ctggggatcggtgtcgccctcgagggcccggccccgtccttcgaggccatgtccgccgcg
ctcaccacggccctgtcgccggaatcccgggagcgggcgatcgccgtcgccgacacgatc
cgcgaggacgggacgacggccgccgtcgaactgctgcgtgaagcggtcagccgggaaaag
ccgtctgttccggcctga

DBGET integrated database retrieval system