KEGG   Amycolatopsis sp. YIM 10: YIM_39175
Entry
YIM_39175         CDS       T06270                                 

Name
(GenBank) Rhamnosyl O-methyltransferase precursor
  KO
K18062  cephamycin C biosynthesis protein
Organism
amyy  Amycolatopsis sp. YIM 10
Pathway
amyy00311  Penicillin and cephalosporin biosynthesis
amyy01100  Metabolic pathways
amyy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amyy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    YIM_39175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:amyy01008]
    YIM_39175
Polyketide biosynthesis proteins [BR:amyy01008]
 Nonribosomal peptide tailoring proteins
  Others
   YIM_39175
SSDB
Motif
Pfam: CmcI DUF1641
Other DBs
NCBI-ProteinID: QFU92987
UniProt: A0A5P9PZ27
Position
complement(8247992..8248690)
AA seq 232 aa
MTDTFLDLNQFRGLGEDPVYHPPVLRDRPRDWPLDRWADAPRDLGYPDFARYQWRGLRML
KDPDTQAAYHDLMCELRPRTIIELGVYSGGSLVWFRDMADLMGLDCQVLGIDRDLSRCQI
PQSEMKNISLREADCADLATFDQLRDLPHPLVFIDDAHANTFNIMKWSVDHLLAEGDYFI
IEDMIPYWHRYCPKLLTEYLAAFRDVLSMDMVYANASSQLDRGVLRRMAPSA
NT seq 699 nt   +upstreamnt  +downstreamnt
atgacggacaccttcctggacctgaaccagttccggggactgggggaggacccggtctac
cacccgccggtgctgcgtgaccggccgcgcgactggccgctcgaccggtgggccgacgcg
ccccgcgacctcggttaccccgatttcgcgcggtaccagtggcgcggcctgcgcatgctc
aaggacccggacacccaggccgcctaccacgacctgatgtgcgaactgcgcccgcgcacg
atcatcgaactcggtgtgtacagcggtggttcgctggtctggttccgcgacatggccgat
ctgatgggccttgactgccaggtgctcggcatcgaccgggacctgagccgctgccagatc
ccccagtccgagatgaagaacatctcgctgcgtgaggccgactgcgccgacctggcgacc
ttcgaccagctccgcgacctgccgcacccgctggtcttcatcgacgacgcgcacgcgaac
acgttcaacatcatgaagtggtcggtcgaccacctcctggcggaaggcgactacttcatc
atcgaggacatgatcccgtactggcaccggtactgcccgaagctgctgaccgagtacctc
gccgcgttccgcgacgtgctgagcatggacatggtctacgccaacgccagttcccagctg
gaccgaggcgtgcttcgccgcatggcgccgtcggcctag

DBGET integrated database retrieval system