KEGG   Anabaena sp. 90: ANA_C11020
Entry
ANA_C11020        CDS       T02341                                 
Symbol
leuC
Name
(GenBank) 3-isopropylmalate dehydratase large subunit
  KO
K17749  3-benzylmalate isomerase [EC:4.2.1.-]
Organism
anb  Anabaena sp. 90
Pathway
anb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
anb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:anb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ANA_C11020 (leuC)
Enzymes [BR:anb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     ANA_C11020 (leuC)
SSDB
Motif
Pfam: Aconitase Aconitase_C AcnX
Other DBs
NCBI-ProteinID: AFW93808
UniProt: K7WEB0
Position
chANA01:1130042..1131757
AA seq 571 aa
MSSIKQILYLGDDINTDDIMPANRATNDDPDNLKHYALEHLIGVGELLKYDVIEAGENFG
CGSSREIAPIAIKAAGIELIRAKSFAEIFYRNSINIGLPLEILGEKPENPVVNVIAAAGG
LIPFNQKRRQGKITIPASATSPRPMTLVEKLLAKSSGNTYVTPGEVVFAQVDLALSHDAV
ASPVAKIFYKHYGEDAKLWDAQRVVLVADHFIQVNDIRVDHKAELMYQQMVQFAKDQECY
LFDVVSPGEAAGICHVLLPEKGFVRPGMIIAGTDSHTCTYGALGAFSTGVGTTDMANIYA
MGDMWIRVPSTLVFDLSGTLPHHISAKDIILFILGQIGCAGATGKVMEFRGSILAQLPFD
ERLTLANMAIECGAVCGLIVPDETTRNYVRSRSTQGFVEMIADPDAEYEKVYQFDLSNLE
PQVARPPKPDQVIPISQLEETPITKAFIGSCTGGKLYDLAQAAEVLQGRQLADGVSLFVV
PASVEIREQAEALGYLEIFAQAGAQILKSGCGACINSGMGVLDKEETGVYATNRNFKGRS
GDPTGKNYLASPRTVAISAIKGKISHLLDEK
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgagtagtatcaaacagattttatacttaggtgatgatatcaatactgatgatattatg
cctgccaaccgggcgacaaatgatgaccctgataatttgaaacactatgctttagaacat
ctcattggagtaggggagttactaaaatacgatgtgattgaagccggagaaaatttcggc
tgtggttctagtcgagaaattgcccccattgccatcaaagctgccggaatagaactgatt
cgggcgaaatcgttcgcagaaattttttatcgcaatagcattaatattggacttcccctg
gaaattttaggagaaaaaccagagaatccggtagttaatgtgatcgccgcagccggtgga
ttgataccttttaatcaaaagcgtcgtcagggaaaaattaccattcctgccagcgcgact
tccccgcgacccatgactttagtggaaaaacttttagccaaatcctctggtaatacctac
gtcactccaggagaagtggtttttgctcaagttgatttagccctatcccacgatgctgtg
gccagccctgtcgctaaaatattttataaacactatggagaagatgcaaagctgtgggat
gctcaacgggtagttttagtcgcagatcacttcatccaagtcaatgacatccgtgttgat
cacaaagctgaactcatgtatcaacagatggttcagtttgccaaagaccaagaatgttac
ttatttgatgtagtttccccaggggaagccgcaggtatctgtcacgttttacttccagaa
aaaggatttgtccgaccagggatgatcattgccggcacagattcccatacctgcacctat
ggagcattaggagctttttccacaggagtgggaactacggatatggcgaatatctatgct
atgggggatatgtggattcgtgttccatcaacattagtatttgatttatcgggaactcta
ccgcaccatattagtgccaaagatattatcttgtttatcttaggtcaaattggttgtgct
ggtgctaccggtaaggtaatggagtttagaggatcaatactcgcacaactaccttttgat
gaacgattgactttagctaatatggctattgagtgtggtgcagtctgtgggttaattgtt
cctgatgaaacaacccgaaattatgtcagaagtcgttctacacaagggtttgtagaaatg
attgccgatcctgatgctgaatacgaaaaagtatatcaatttgacctcagtaatttagaa
ccacaagttgcccgtcctccaaaaccagatcaggtcatacctattagccagttagaggag
actccgattaccaaagcttttattggctcttgtacggggggcaagctttatgatttagcc
caggctgctgaagttttacaaggtcgtcaactggcagatggcgtgagcttgtttgtggtc
cctgcttccgtagagattcgtgaacaagctgaagccttgggttatctggaaatttttgca
caagcaggcgcacagattctcaagtcaggttgtggagcttgtattaattctggaatgggg
gtgttagataaagaagaaacaggagtttatgcaaccaatcgcaactttaaaggacgtagt
ggcgatcctacaggtaaaaactatttggcctcgccaagaacagtggcaatatcagccata
aaggggaaaattagccaccttctggatgaaaaataa

DBGET integrated database retrieval system