KEGG   Aspergillus niger: ANI_1_1096124
Entry
ANI_1_1096124     CDS       T01030                                 

Symbol
An14g01060
Name
(RefSeq) DNA repair protein Rhp26/Rad26
  KO
K10841  DNA excision repair protein ERCC-6
Organism
ang  Aspergillus niger
Pathway
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_1096124 (An14g01060)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ang03036]
    ANI_1_1096124 (An14g01060)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_1096124 (An14g01060)
Chromosome and associated proteins [BR:ang03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    ANI_1_1096124 (An14g01060)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Other TCR factor
      ANI_1_1096124 (An14g01060)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII TFIIF_beta
Other DBs
NCBI-GeneID: 4986960
NCBI-ProteinID: XP_001400735
AA seq 1214 aa
MDGAKLNDVDVAASRSGFDEDMKKEEEPEQQAKSTLDPAESEASLNQGHSANADEASRLR
ELQADVRDQDDLERDISRQADRLLMEQADERDSKRLEKTTLEKQKLESQILKLHQRLSQP
VGTSARVRISNEIEKLESRNTALATDLKEIQQRMDERHQGDEAGSQTTGTGRMPNESRRD
YLIRTGKITPFSNMSSGPNHGPLASLQDALIDAEDERDEKEALEQVKNRSAVSHRNLVRP
GFGFDETPASSLVDEAPTSRASKRRKIDRESHEEEEEALEQETKVSLEDNFEDQDESASY
VESERQSSVSEDEEEFLPEERPKRTAKPVKAPKSSDEVEDFSGMDDGNEELYQTRLQYWV
SRRAAARKRALESRVAGHGPEVDAAGDNEEWFMPHPTVSDMPYDNGYRIPGDIHPLLFDY
QKTGVQWLWELQQQQVGGIIGDEMGLGKTIQVISFLAGLHYSKKLTRPVIVVCPATVMKQ
WVNEFHRWWPPFRVSILHTSGSGMVNIRNESSREDALLSQAWNASSTRGMPSGLKAARKV
VKRVVEEGHVLVTTYSGLQTYASLVIPIEWGCAVLDEGHKIRNPNTSITIHCKELRTPHR
IILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFRNQFEFPIRQGGYANASNLQVQTAAKC
AETLKDAISPYLLQRFKIDVAADLPKKSEQVLFCKLTKPQRQAYEAFLGSEEMKSILNGR
RQVLFGVDILRKICNHPDLQNHKLMSSTTGYGSGSKSGKMQVVKSLLELWKDTGHKTLLF
TQHRIMLDILEKFVNSLSGFSYRRMDGTTPIQHRQAMVDEFNNDPSLHVFLLTTKVGGLG
VNLTGADRVIIYDPDWNPSTDVQARERAWRLGQKRDVTVYRLMTAGTIEEKIYHRQIFKQ
FLTNKILRDPKQRQTFQLSDLHDLFSLGDEGQGPTETSKIFKDADVTYEDSDGTSRKSNA
AIKSSASSHSAQEEKKDISKVVGVAAVEQFQGDQEQQSEQEKGTSGANSESRIMEGIFAR
SGVHSALEHDQIVNGKRVVRADPKIIEAEAKRVAAEAAEELRRAGEAARSVPIGTPTWTG
QFGLAGKPEEQLPSRPAFGGSSSAARRAVAGPSSASILANLSARTPSPRSSSNSPAPSRT
PSGIDFITMIRDFITAQGGSVYTQMLIDHFNRYCTTPQRSAEFKEMLKTIAVLDKGGRNG
RGKWALKPEYAKRR
NT seq 3645 nt   +upstreamnt  +downstreamnt
atggatggggcaaaattgaacgacgtggatgtcgctgcatcccggagtggctttgacgaa
gacatgaaaaaggaggaagagccggagcaacaagcgaaatctacattggatccagctgag
tctgaagcatctctaaatcaagggcattcggcaaacgccgatgaagcaagtcgattacgt
gaattgcaggccgatgttcgtgatcaagatgacctcgaaagggacatatctcgtcaggcc
gacaggttgctcatggagcaggctgacgaacgggatagtaaaagattggagaaaaccaca
ttagagaaacagaaacttgagagccaaatcttgaaactacatcagcgtttgtcgcagcca
gttggcacgtctgcgagagttcgcatcagcaatgagattgagaagctggagagccgcaat
acggcactggcaactgaccttaaagaaattcagcaaagaatggacgaaagacatcaagga
gatgaggctggttctcagactaccgggactgggcgcatgcctaatgagtcccgccgggat
tatctcattcgaactggaaagattacgccattttccaacatgagctctgggccaaatcat
ggccctcttgctagtcttcaggatgccttgatcgatgcagaggacgaacgcgatgaaaag
gaagcactggagcaggtgaagaaccggtcagctgtttcacatcgtaatctcgtacgacct
ggattcggtttcgatgagactcctgcttccagcttagtggatgaagcgcctacctctcga
gcaagtaagcgtcgaaagatagaccgcgagtctcatgaggaggaggaagaagctcttgaa
caagaaaccaaggtatccctcgaagacaatttcgaggatcaagatgagtctgctagctat
gttgaatctgaaaggcagtcttctgtatcggaagatgaagaagaattcctgcctgaagaa
aggccaaaacgtacggcaaagccagtaaaggctccaaagtcttcggacgaggttgaagat
ttcagcggaatggacgatggaaatgaagagctctatcaaactaggcttcaatattgggtc
agtcgaagggcagctgctaggaaaagagcgcttgagtcgcgtgttgcaggtcatggaccc
gaggtggatgctgctggggacaatgaagaatggttcatgcctcatcccacagtttcagat
atgccctacgacaacgggtatcgaatacctggtgatatacatccccttttgttcgattat
caaaagaccggagtacaatggttatgggaattacaacagcagcaagtaggtgggatcatc
ggcgatgagatgggtcttgggaagactattcaagtcatctctttccttgctggtctccat
tacagcaaaaagttgacgaggccagtcatcgttgtatgtcccgctacggtcatgaagcag
tgggtgaatgagttccaccgttggtggcctcctttccgtgtatccatcctgcacacgtcc
ggtagtggaatggtcaacattcggaacgagagcagcagagaagatgctcttttgtctcag
gcgtggaacgcctcgagtactcgtggcatgccaagtggcctgaaagcagccaggaaagtc
gtcaagcgtgtagtagaagaagggcatgtactggtaaccacttactcgggcctacagacc
tatgcttctctcgtgataccgattgaatggggctgtgctgtcctggatgaagggcacaaa
atccgcaacccgaacacctcgattactatccattgcaaggaactccggacaccccatcgc
attattctatctggcaccccgatgcagaacaatcttacagagctctggtctttattcgac
ttcgtctttccaatgcgcctgggaactctggtgaatttccggaaccaattcgagttcccg
attcgtcagggagggtacgcgaatgcctctaatctgcaagtccagacagctgccaaatgt
gccgagaccctcaaggatgccatcagcccctatcttttacagcggttcaagatcgatgtt
gcggcagatcttcctaagaagagtgaacaagtgctgttctgcaagttgacaaagccgcaa
cgacaggcgtacgaggcgttccttggctccgaggagatgaaatccatcctcaacgggcgt
cgacaagtcttgttcggtgtcgatatattacgaaagatttgcaaccatccggatctacaa
aatcataagctgatgtcctcaacaaccggctatggtagcggatccaagtcgggtaaaatg
caggtcgtcaaatcgctgctggagctatggaaggataccggtcacaagactttgctgttc
acgcagcatcggatcatgctcgatattctggagaaatttgtgaactcactgtctggattt
agctaccgtcgaatggatggcaccacacccatccagcaccggcaagctatggtggacgag
ttcaacaatgacccaagcctacatgttttcctccttaccactaaagttggcgggctgggg
gtaaatctaacgggtgctgatcgggtgatcatatacgatcccgattggaacccatcaact
gatgtgcaggcgcgggagcgggcctggaggctaggacaaaagcgcgacgtcaccgtctat
cggcttatgaccgcaggcactattgaagagaagatctatcatcgtcagatctttaagcag
tttctcacgaataaaatcctccgggatcccaagcaacgccagactttccagctaagcgac
ctccatgatctcttctctcttggagacgaaggccaaggccccaccgagaccagtaagatc
tttaaagatgcggacgtcacatatgaagacagcgatggcacctcgcgcaagtctaatgca
gcgatcaaatcatctgcctcctcgcatagcgcgcaggaggagaagaaagacatcagcaag
gtcgtgggtgtcgccgctgtcgaacagttccagggagaccaagagcaacagagcgagcag
gagaagggcacttcaggtgccaactccgagtcccgcatcatggagggcatctttgcccga
tccggggtccattcggcgctggagcatgatcagattgtgaatggcaagcgcgtggtgcga
gcggaccccaaaataatcgaggccgaagcgaagcgggtggcagctgaagctgcagaggag
ctgcggcgagcgggtgaagcagcgcggtccgtccccatcggcactccaacctggacgggt
caattcggcctggccgggaaacctgaggaacagttacccagccggcctgcatttggagga
agcagtagcgccgccagacgagcggtagccggaccatcctcagccagcattttggcgaat
ctctcggcgcgcacaccttcaccgcgcagcagcagcaacagtcctgcgccatcgcggact
cccagtggaatcgatttcatcaccatgatccgggatttcattacggcccagggcgggtca
gtctatacccaaatgttgatcgatcatttcaaccggtactgcaccacgccgcaacggtcg
gccgagttcaaggagatgctgaagacgatagccgtgttggacaaggggggacgaaacggg
cgcgggaaatgggctttgaagccggaatatgccaagcgacgatga

DBGET integrated database retrieval system