KEGG   Aspergillus niger: ANI_1_112094
Entry
ANI_1_112094      CDS       T01030                                 

Symbol
An11g00720
Name
(RefSeq) DNA polymerase delta subunit 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03410  Base excision repair
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
ang03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_112094 (An11g00720)
   03410 Base excision repair
    ANI_1_112094 (An11g00720)
   03420 Nucleotide excision repair
    ANI_1_112094 (An11g00720)
   03430 Mismatch repair
    ANI_1_112094 (An11g00720)
   03440 Homologous recombination
    ANI_1_112094 (An11g00720)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_112094 (An11g00720)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_112094 (An11g00720)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    ANI_1_112094 (An11g00720)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      ANI_1_112094 (An11g00720)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     ANI_1_112094 (An11g00720)
SSDB
Motif
Pfam: DNA_pol_delta_4 MIC19_MIC25 EF-1_beta_acid
Other DBs
NCBI-GeneID: 4984298
NCBI-ProteinID: XP_001394076
UniProt: A5ABK7
AA seq 197 aa
MPPSRRRGGNTAATRSNQATLSFGSKSRVTKPSAAPSTRSQKAKDLDLIDTTRSSTPSVE
DVSEAEQASVTPTEPSQPHVAELAVRKQAQTEIQQPRSEEDAKAEKITERQLQQYWKKEE
AKRQGPRVHQEGLELREKILRNFDLSSQYGPCIGIARLKRWRRAHMLGLNPPIEVLAVLL
KPDDTTKQRAYIDELMS
NT seq 594 nt   +upstreamnt  +downstreamnt
atgcctccctctcgtcgccgcggtggcaatactgccgccacccgttcaaaccaggcgacc
ttatcgttcggctccaagtccagagtcacgaagccatcagcagcgccatctacacgctct
cagaaagccaaagatctcgacctgattgatactactcgatcgagtacaccatccgttgaa
gatgtgtccgaagcagaacaggcctctgttactcccacggagccttcgcaaccccatgtg
gcagagcttgccgtaaggaagcaggctcagacagagattcaacaaccacgatcagaagag
gatgctaaggcggaaaagattaccgaaaggcagctgcagcagtactggaagaaggaagaa
gcaaagagacaagggcccagagttcaccaggagggcctcgagctacgagagaagattctg
cgcaacttcgacctctcaagccagtacgggccttgcattggaattgctcgactgaagcgg
tggagacgtgcgcatatgctgggcctcaatcctcccattgaggtgttggccgtgttgttg
aaaccggacgataccactaaacagagagcgtatattgacgagttgatgtcttga

KEGG   Aspergillus niger: ANI_1_116094
Entry
ANI_1_116094      CDS       T01030                                 

Name
(RefSeq) DNA polymerase delta subunit 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03410  Base excision repair
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
ang03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_116094
   03410 Base excision repair
    ANI_1_116094
   03420 Nucleotide excision repair
    ANI_1_116094
   03430 Mismatch repair
    ANI_1_116094
   03440 Homologous recombination
    ANI_1_116094
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_116094
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_116094
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    ANI_1_116094
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      ANI_1_116094
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     ANI_1_116094
SSDB
Motif
Pfam: DNA_pol_delta_4 MIC19_MIC25 EF-1_beta_acid
Other DBs
NCBI-GeneID: 10098229
NCBI-ProteinID: XP_003188806
UniProt: A5ABK7
AA seq 197 aa
MPPSRRRGGNTAATRSNQATLSFGSKSRVTKPSAAPSTRSQKAKDLDLIDTTRSSTPSVE
DVSEAEQASVTPTEPSQPHVAELAVRKQAQTEIQQPRSEEDAKAEKITERQLQQYWKKEE
AKRQGPRVHQEGLELREKILRNFDLSSQYGPCIGIARLKRWRRAHMLGLNPPIEVLAVLL
KPDDTTKQRAYIDELMS
NT seq 594 nt   +upstreamnt  +downstreamnt
atgcctccctctcgtcgccgcggtggcaatactgccgccacccgttcaaaccaggcgacc
ttatcgttcggctccaagtccagagtcacgaagccatcagcagcgccatctacacgctct
cagaaagccaaagatctcgacctgattgatactactcgatcgagtacaccatccgttgaa
gatgtgtccgaagcagaacaggcctctgttactcccacggagccttcgcaaccccatgtg
gcagagcttgccgtaaggaagcaggctcagacagagattcaacaaccacgatcagaagag
gatgctaaggcggaaaagattaccgaaaggcagctgcagcagtactggaagaaggaagaa
gcaaagagacaagggcccagagttcaccaggagggcctcgagctacgagagaagattctg
cgcaacttcgacctctcaagccagtacgggccttgcattggaattgctcgactgaagcgg
tggagacgtgcgcatatgctgggcctcaatcctcccattgaggtgttggccgtgttgttg
aaaccggacgataccactaaacagagagcgtatattgacgagttgatgtcttga

KEGG   Aspergillus niger: ANI_1_1296184
Entry
ANI_1_1296184     CDS       T01030                                 

Symbol
An04g08720
Name
(RefSeq) hypothetical protein
  KO
K03504  DNA polymerase delta subunit 3
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03410  Base excision repair
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
ang03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_1296184 (An04g08720)
   03410 Base excision repair
    ANI_1_1296184 (An04g08720)
   03420 Nucleotide excision repair
    ANI_1_1296184 (An04g08720)
   03430 Mismatch repair
    ANI_1_1296184 (An04g08720)
   03440 Homologous recombination
    ANI_1_1296184 (An04g08720)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ang01009]
    ANI_1_1296184 (An04g08720)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_1296184 (An04g08720)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_1296184 (An04g08720)
Protein phosphatases and associated proteins [BR:ang01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ANI_1_1296184 (An04g08720)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    ANI_1_1296184 (An04g08720)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      ANI_1_1296184 (An04g08720)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     ANI_1_1296184 (An04g08720)
SSDB
Motif
Pfam: CDC27
Other DBs
NCBI-GeneID: 4991276
NCBI-ProteinID: XP_001402230
AA seq 447 aa
MAVADYKRYLAENVLNERRTVTYRSLGRALRVHSTLAKQMLFDFHRNENSKKPNSVNATY
IITGVQKAPETPSTTNGAQDSFDGIPQSSPYISSSMPNQDVATDEIAMSSVVLVREEDLE
DAKTTFQSVSSIYVYSLQPAVLQDLNVLTDVASEMIAKHAQEDPLEYGKSWGMIQGNNVR
RRTGGRPPVPAPAQAPAPPKTTIPAKRPIKNEETPQLKKETEAEAAKPEPTTKREETPAS
TKPTEKTAPPKQKGSIFSSFAKAKPKQKIEDSTTPATSAAESAEPSGAEDVVLDDASDGD
EEPEELFRDSGKSASAGTRESRKEREERLRKMMEDDDEDEDEEMPDAAPSPEESKPIDEP
PRPKQAELKEEVTVKGGRRRGRRQVMKKKTVKDDEGYLVTVEEPSWESFSEDEPAPPPKK
KPAVSAPKGKPAAKPGQGSIMSFFSKK
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggctgttgctgattacaagaggtaccttgctgagaatgtcctcaatgagcgacgcacg
gtcacctaccggtccttaggtcgagcccttcgggttcatagtaccctggccaagcagatg
ctcttcgattttcaccgtaacgaaaacagcaagaagccaaacagcgtcaatgcgacttat
attattacgggagttcagaaagcgcccgagactccttccacaacaaatggcgctcaggac
agctttgatggaattccccagagcagtccctacattagcagttcgatgccgaatcaggac
gtcgctacggatgagatcgccatgtcctcggttgtgcttgtgcgagaggaagacttggag
gatgccaagacgaccttccaatcagtctcatcgatatacgtctacagccttcagccagcg
gtactccaggatctcaatgtcttgacagatgtcgcgagtgaaatgattgccaagcatgct
caggaggatcctctagaatacggcaaatcttggggcatgatccagggcaacaatgtccgg
agaagaaccgggggccgccctcccgttccagcccccgctcaggctccagctcctcccaag
acgaccattccagctaagcgtcctatcaagaatgaagagacaccacaactaaagaaagaa
actgaagccgaggctgcgaagccagagccgacgactaaacgcgaggaaacaccggcgtct
actaaaccgactgagaagacagctcctccgaagcaaaagggcagtatatttagctccttt
gcaaaggccaagccgaagcagaaaatagaggattcaaccacgccggccacttctgctgcc
gaatcggccgaacccagtggtgctgaagatgtggttctagacgatgcatcggacggggat
gaggaacctgaggagcttttccgggactcagggaagtccgcgtccgccggtacacgtgag
tcgcggaaagagcgtgaagaaaggctcagaaagatgatggaagatgatgacgaagacgaa
gacgaagaaatgcctgacgctgcaccctcaccggaagagtctaagcctatcgacgagccg
ccgcggccgaaacaagctgagctcaaggaagaagtcacggttaagggcggtcgtcgcagg
ggcaggcgccaagtcatgaagaagaagacagtcaaggacgatgagggctatctggtgacc
gttgaggagccaagctgggagtcattctcagaagacgagccagcaccgcctcctaagaag
aagcccgctgtgagcgcgcccaagggcaaaccagcagcgaaaccaggacaaggcagcatt
atgtccttcttctcaaagaagtga

KEGG   Aspergillus niger: ANI_1_476184
Entry
ANI_1_476184      CDS       T01030                                 

Symbol
An04g02280
Name
(RefSeq) DNA polymerase delta subunit 2
  KO
K02328  DNA polymerase delta subunit 2
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03410  Base excision repair
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
ang03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_476184 (An04g02280)
   03410 Base excision repair
    ANI_1_476184 (An04g02280)
   03420 Nucleotide excision repair
    ANI_1_476184 (An04g02280)
   03430 Mismatch repair
    ANI_1_476184 (An04g02280)
   03440 Homologous recombination
    ANI_1_476184 (An04g02280)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_476184 (An04g02280)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_476184 (An04g02280)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    ANI_1_476184 (An04g02280)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      ANI_1_476184 (An04g02280)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     ANI_1_476184 (An04g02280)
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Other DBs
NCBI-GeneID: 4990633
NCBI-ProteinID: XP_001401596
AA seq 533 aa
MASSDEFLRPPTNEEFDATTRVPSHYKPLDTFRLGSGQDRHYQQQYGDMYFLRLAKLKPA
VEEIAVEAWEGFSIAGENARRVERVLDVRQGELCWVAGTIYMDMPLKPNILDDLTKENYT
LAPPPRPTYQDPAHPELTQIMLEDESGRLRLTGSMLRNTQLCTGAIIAVLGTENANGDFE
VIDTKVPDLPQQPRRWGSDTLDAPTGAMKGKIAFVSGLGITGTSSDTLALELLADYLLGY
TGGASEGALPDASAITRLIIAGNSVGASMTTDVNADSATKKRTGPKKYGYDASAYNASPI
TRLDSFLAEILPSMPVTLMPGESDPANFSLPQQGIHRAMFPQARAYCAPPPAGEDKKEPG
WFDSVTNPWEGDVEGWRLWGSSGQNVDDILRYLNFADEEGNVADGAGDSEARMRVMEAML
RWRCGVPTAPDTLWSYPFQTHDPFVIQTCPHIFFAGNQPQFKTAVIEGDAPLKLNGADTE
MTGTDDDNTSGPRVRLLSIPKFKETGELVLVDTETLEVEVVKFSTFAGQQEQQ
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcaagcagcgacgagttcctgcgccctcccaccaatgaagaatttgacgcaaccacc
cgtgtaccctcacattataaacctttggacacatttcgactgggaagcggccaggatagg
cattaccagcagcaatatggcgacatgtacttcttgcggttggcaaaactcaagcccgca
gttgaggagattgcagtcgaagcatgggaaggttttagtatcgctggagaaaatgcgcgc
cgcgtggagagagtcctcgacgtgaggcagggagagctttgttgggtcgcaggaacgata
tacatggacatgccattgaagccgaatattttggacgatcttacaaaagagaactatacg
ttagcaccacctccgcggccgacttaccaagatcctgctcatccggagttgactcaaatt
atgttggaagacgagtccggccgactgcgcctaactgggagcatgctccggaacacgcag
ttatgcacaggagccatcattgcagtcctgggaaccgagaacgcaaatggagatttcgag
gttatagataccaaagtgcctgatctaccacaacaaccccgccgatgggggagcgataca
ctggacgcaccaacgggagccatgaagggtaagatcgcatttgtgagcggcttagggatc
accggaacttcgagcgatactcttgctttggaacttttggcagactatttgcttggttat
accggtggtgcttctgaaggtgcactgcccgatgcttctgcaatcactaggttgattatt
gcgggaaattcagttggagcgagcatgactacggatgtcaacgccgatagcgctacaaag
aaaaggaccggtccgaagaagtacggatatgatgcttctgcttataatgcatcgcctatt
acgcgacttgattctttcctagcagagatcctgcctagtatgcccgtcacacttatgcca
ggcgaatctgacccggcaaacttttctctccctcaacagggaatccaccgtgctatgttc
ccacaggctagggcatactgtgctccgcctcctgctggtgaggacaagaaagagccaggt
tggttcgacagtgtaacgaacccgtgggaaggggacgtggaaggatggcgactatggggc
agcagtggtcagaatgtggatgacatcctccggtatttgaatttcgcagatgaggaaggg
aatgtggccgatggtgctggagattcagaggcgaggatgagggtcatggaggctatgctg
cgctggagatgtggagttcccaccgcgcccgatacactatggtcctatccattccaaaca
catgatccattcgttatacaaacctgcccgcatattttctttgctggcaaccagccacag
ttcaagacagctgtaattgagggtgatgccccactgaagctgaacggagccgacacggag
atgacaggaacagatgacgataacacatctgggcctcgtgtgcgccttctatctataccc
aagttcaaggaaaccggagaactagttttggtcgacaccgagaccctcgaggtggaagtg
gtgaagtttagcacatttgccggacaacaagagcaacaataa

KEGG   Aspergillus niger: ANI_1_982134
Entry
ANI_1_982134      CDS       T01030                                 

Symbol
An15g07150
Name
(RefSeq) DNA polymerase delta catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03410  Base excision repair
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
ang03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_982134 (An15g07150)
   03410 Base excision repair
    ANI_1_982134 (An15g07150)
   03420 Nucleotide excision repair
    ANI_1_982134 (An15g07150)
   03430 Mismatch repair
    ANI_1_982134 (An15g07150)
   03440 Homologous recombination
    ANI_1_982134 (An15g07150)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_982134 (An15g07150)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_982134 (An15g07150)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ANI_1_982134 (An15g07150)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    ANI_1_982134 (An15g07150)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      ANI_1_982134 (An15g07150)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     ANI_1_982134 (An15g07150)
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2
Other DBs
NCBI-GeneID: 4988316
NCBI-ProteinID: XP_001397242
UniProt: A2R6A0
AA seq 1105 aa
MPEAVAMPQKRVLGDASNNPRGVVTDPSALKKRRIENGPAAAMKPPTNGQRRVPGSSQPQ
KSQFEEEVLEKLTQDINGLKDSNSEKDQQWERPPLGEFDPSTENICFQQIDAEEGTIMGG
KTAVRLFGVTEAGQSVLLHVTGFQHYLYIAAPVNFTKDDCEPYRAFLESRVGQFQPTIQS
VQITMRENIYGFQGNQKSYYLKITVTDPKFISKVRSALEQGGAQSLNYKGLWNNSDGGIL
TFDSIQYLLRFMIDTDISGMSWVEAKAGKYRLFQQHEKVSNCQIEASVDYRDLISHPPNG
EWAKMAPLRILSFDIECAGRKGIFPEPNQDPVIQIANVVTRYGESKPFIRNVFVLDTCSL
IVNTQILEFKDEGKMLMAWRDFVQKVDPDVIIGYNIANFDFPYLLDRAKHLKCTGFPYWT
RLNGVQSQSKETNFSSKQMGNRDTKSTNTNGRIQLDMLQLVQRDYHLRSYTLNSVSYEFL
GEQKEDVHHTMITELYNGTPDSRRRLAVYCLKDAYLPQRLMDKLMCLVNYTEMARVTGVP
FNFLLSRGQQVKFISQLFRKALEQQLVIPNTKSNDEQDYEGATVIEPVRGYYGVPIATLD
FASLYPSIIQAHNLCYTTLLNKSSVERLKLVKDEDYIVTPNGDMFCTAKVRKGLLSQILE
ELLSARKRAKKELAVETDPFKKAVLNGRQLALKISANSVYGLTGATVGKLPCLPIASSTT
SYGRQMIEKTKQEVEARYTIANGYSHDAKVIYGDTDSVMVKFGVDNLEEAMKLGQEASEY
VSSKFLKPIKLEFEKVYFPYLLINKKRYAGLYWTNPNKYDKMDTKGIETVRRDNCLLVQN
VIETVLQKILVERDIDGAQDYVKDTISDLLQNKIDMSKLVITKALSKDAYTAKQAHVELA
ERMRKRDAGSAPTLGDRVAYVIIKGAGGSKNYERSEDPIYVLENNIPIDTKYYLDNQLAN
PLGRIFEPILGEKKASQLLTGEHTRAISVAAPTMGGLMKFAKKTQTCLGCKKPLSGKEEA
EGAVCAYCRPRLGELYTKSLTKVSDLEVRFGRLWTQCQRCQGSLHCEVICSSRDCPIFYM
RMKAKKDVEDAQKELSRFDNDAGAW
NT seq 3318 nt   +upstreamnt  +downstreamnt
atgcctgaagccgtcgccatgccccagaagcgggttctgggcgatgcatcaaataaccct
cgtggtgtcgtaacagatcccagtgcgctcaagaagcgcaggatagagaatggccctgct
gccgctatgaaaccgccgacaaatggccagcgccgagttccgggctccagccagccccag
aagagtcaattcgaggaggaggttctggagaaactgacccaggacatcaacgggttgaag
gacagcaattcggaaaaagatcagcaatgggagcgaccgccactgggtgaatttgacccg
tccacggagaatatctgtttccaacagatcgatgctgaagaggggacaatcatgggcggc
aagactgccgttcgactgtttggtgtcactgaggccggtcaatcggtcctcctccacgtt
accgggttccaacactatctctacatcgctgcgccagtgaacttcaccaaagacgactgc
gagccctaccgagctttcctggagagcagagtcggacagtttcaacctacgatccagtca
gtgcaaataacgatgcgagagaacatctacggatttcaaggcaaccagaaaagctattac
ctcaagatcacagttacggatcccaaattcatcagcaaagtccggtcagcgttggaacaa
ggcggggcccaaagcttgaactataaaggtctctggaacaactctgatggcgggattctc
acattcgacagcatccaatacctcctcagattcatgatcgacacggatatttcgggcatg
tcttgggttgaagcaaaggcggggaaataccgcttattccagcaacatgagaaggtgtcg
aattgtcagatcgaggctagtgtcgactaccgagatcttatctctcatccacccaacggc
gagtgggccaagatggccccgttgcgcattttgtcttttgatattgagtgcgctggacgg
aagggtatcttccctgaaccgaatcaagacccagtcattcagatcgccaatgtcgtgacg
cgctacggagagtctaaaccgtttattcgtaatgtgtttgttttagacacatgcagtttg
atcgtcaacactcagatcctcgaattcaaagacgaggggaaaatgcttatggcctggcgc
gatttcgtgcaaaaggtggacccggatgtgatcatcggctacaacattgccaatttcgat
tttccgtatctgttggatcgtgccaagcatctgaaatgcactggcttcccctactggacc
agattgaacggcgtgcagtcgcagagcaaggaaaccaacttctccagcaagcagatgggt
aaccgtgacacgaagtcaacgaacactaatggtcgcatccagctcgatatgcttcaacta
gtacagcgagactaccacttgcgaagttataccttgaactcggtgtcttatgaattcttg
ggcgaacagaaggaggatgtccatcacactatgatcactgagctgtataatggaactccc
gattcaagacggcgtttagctgtctactgcttgaaggatgcgtatctgccgcaaaggctg
atggacaagttgatgtgcctggtcaactacaccgaaatggcgagagtgacgggtgtgccc
ttcaactttttgctgtcacgaggtcagcaagtcaagttcatcagtcagcttttccgcaag
gctttggaacagcagctcgtcatcccgaatacgaaatccaacgacgaacaagactacgaa
ggtgctactgtcatcgagcctgtcaggggctactacggtgtgcctatcgcaaccctcgat
ttcgcatccctatacccgtccatcattcaagcccataatctctgctacacaacgctcttg
aataagagtagcgttgaaaggctgaagcttgtaaaagatgaggactacatcgtgacacct
aacggtgacatgttctgtaccgccaaagttcgcaaaggcctgttgtcacagattttggaa
gaactgctgtctgcacgtaaacgtgctaagaaagagctggccgttgagacagacccattc
aagaaggctgttctgaacggacgacagctcgctctgaagatcagcgccaacagtgtttac
ggtctcacaggtgcaactgttggaaagctgccctgcttgcccatcgcgagtagtacaacc
agttatggacgacagatgatcgagaagaccaaacaggaggtggaagcccggtacacaatc
gcgaatggttattctcatgatgccaaggtcatctatggtgatactgattcggtcatggtt
aagtttggcgttgacaacttggaggaagctatgaagctaggacaagaggcctctgaatat
gtctcgtccaagttcctgaagccgatcaaactggagttcgaaaaggtctatttcccatat
ctcctaatcaacaagaagcggtacgccggattatactggacgaaccccaacaagtacgac
aagatggatacgaagggtatcgaaacagttcgtcgagacaactgcctgctggttcagaat
gttatcgagacggtcctacaaaagattctggttgagcgagacattgatggggcacaagac
tacgtgaaggacaccatttccgacctcctgcaaaataagatcgatatgtccaaactcgtg
atcaccaaggccttgtccaaggatgcgtataccgccaagcaggcacacgtggagctcgct
gagcgcatgagaaagcgtgatgcaggttcagcaccaacgcttggcgaccgtgtggcctat
gtcattatcaaaggtgctggcgggtcaaagaactatgaaaggtctgaagatccaatttac
gttcttgagaacaacatccccatcgacacgaaatactatctcgacaaccaactagccaat
ccgctaggtcgtattttcgagcccattctcggagaaaagaaagccagtcagctcctcaca
ggcgaacatacccgtgccatctctgtggctgcgccaaccatgggcggactgatgaagttc
gctaagaagacgcaaacctgccttggatgcaagaagcctttatccggcaaagaagaagcg
gagggcgcagtgtgcgcttactgccgtcctcgcctcggcgagctctacaccaagtcattg
accaaagtatcagacctggaagtccggtttggacgactctggacccaatgtcagcgttgt
cagggcagtttgcactgtgaagtcatctgctcgtccagggattgccctattttctatatg
cgcatgaaggcaaagaaggacgtggaggatgcgcaaaaagaactgtctcggtttgataat
gatgcaggtgcatggtaa

DBGET integrated database retrieval system