KEGG   Aspergillus niger: ANI_1_1194184
Entry
ANI_1_1194184     CDS       T01030                                 

Symbol
An04g07490
Name
(RefSeq) WD repeat protein
  KO
K10570  DNA excision repair protein ERCC-8
Organism
ang  Aspergillus niger
Pathway
ang03420  Nucleotide excision repair
ang04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    ANI_1_1194184 (An04g07490)
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_1194184 (An04g07490)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ang04121]
    ANI_1_1194184 (An04g07490)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_1194184 (An04g07490)
Ubiquitin system [BR:ang04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     ANI_1_1194184 (An04g07490)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      ANI_1_1194184 (An04g07490)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 4991154
NCBI-ProteinID: XP_001402111
AA seq 476 aa
MNAYLLNRALGSISPSTFHAAQTTRLVQQLEPAPGIRFSAQSQAGNEYPHEDAGLVFDDE
VFAHKAGVNVLAIDHYEGRFMVSGGADPSINLWDLETRGSDLKHVHQPVASVNRASHEDA
HTRAITSVSIYPFDPTPSTILTTSYDGTLKLSALGPGAITPVHTFNLDCTPYTHSLSSNP
GSPLLIAVGTSEKPVRLLDLRSGLSTHGLPGHESSVLSVSWAPHQPHILASASADNRVIL
FDIRRGGHNSAIAALDMDDAVGLVRPGSIPASYQSRPAFSPHARAHNGAVTGVRWTSSGS
HLVTAGQDSRIRVWDAGTGANTLVHFGQRVRNSVTSHLAERAPLIIPRGMVIPGQETLLW
PNFNERDDRGEIFMFELREGAFVKLLRVPGLMTGRQQFQGRSSALSAARINALAWRGNGS
SGEGIEMYSAHGDGTIRTWASREPEGEPDDEAAEAERADRKRKRDILDELYRGFIG
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgaatgcgtatcttctcaatagggctttagggtccataagtccctcgacctttcatgcc
gcacaaaccacacggcttgttcaacagctcgagccggcgcctggcattcgcttctcagca
caaagtcaggctggaaatgaatatcctcatgaggatgcaggattggtctttgatgatgaa
gtattcgctcataaggcgggagtgaatgtgctcgccatcgatcactatgagggccgattc
atggtttctgggggtgcagatccttcgattaatctctgggatctggagacacggggctcg
gatctgaaacatgtgcaccagcctgtggcatcagtcaacagagcctcgcatgaagatgcc
cacacacgtgccattacctccgtctctatatacccatttgatcccaccccgtctactatt
ttgacaacctcgtacgatggcacactcaagctttcggctttagggccgggggcgatcaca
cctgtgcacactttcaacctagattgcaccccgtacacccattcgttgtcgtcaaatcca
gggtctcctttactcattgcagtaggtacctcagagaagccggtccgattgcttgaccta
cgttcaggcttgtcgacgcatggtctccccgggcatgaatcttcagtcctgtccgtatca
tgggctcctcatcagccacacatattggcttctgcgtcggcagataatagagtaattctc
ttcgatatccgccgaggaggccacaattcagccatcgctgcactagacatggatgatgct
gtcggacttgtacgcccgggatccatcccagcatcctaccagagccgcccagcattctca
ccgcacgctcgagcccataatggcgctgtgaccggcgtgcggtggacgtccagtggtagt
cacctggtgaccgctggccaggactctcggattcgggtctgggatgccgggacaggtgcg
aatacgcttgtgcacttcggtcagcgcgtgcggaacagtgtaacttcgcacctggccgaa
agggcaccgctaattatacctcgcggaatggtcattccagggcaagaaacccttttatgg
ccgaatttcaatgagagagacgaccgcggggagatcttcatgtttgaacttcgagagggg
gcttttgtcaaactcctccgcgtaccgggacttatgaccggtcgtcagcagttccaggga
cgctcaagtgccctcagcgctgcgaggatcaacgcccttgcttggcgcggcaacggttcc
tcaggagaagggatcgagatgtattcagcccacggcgacgggaccattcgcacatgggcc
tcacgggaacccgagggtgagccggatgatgaagccgccgaagccgaacgagcagaccgc
aagcgcaagcgcgacattctcgacgaactctaccgaggatttataggctaa

DBGET integrated database retrieval system