KEGG   Aspergillus niger: ANI_1_1244084
Entry
ANI_1_1244084     CDS       T01030                                 

Symbol
An09g02820
Name
(RefSeq) DNA repair protein Rad4
  KO
K10838  xeroderma pigmentosum group C-complementing protein
Organism
ang  Aspergillus niger
Pathway
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_1244084 (An09g02820)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_1244084 (An09g02820)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      ANI_1_1244084 (An09g02820)
SSDB
Motif
Pfam: Rad4 BHD_3 BHD_1 BHD_2 Transglut_core
Other DBs
NCBI-GeneID: 4983815
NCBI-ProteinID: XP_001393596
UniProt: A2QTP4
AA seq 944 aa
MASRGPTTRSRRAGAASNHSRRQREDQDHEIPAVYREMLAEAEIRETSRPDDSQLPKRRR
ITRPNPVSDSQLVHQDAAITSEASHSTVQPVQTVYDSPSSSEESGMEWEEVDIQQAPQTS
QADDTSIQVTLGRPEDQKRKVVAKRRGITTAEKQLRLSIHKVHLLCLLRHVQIRNLWCND
EELQGFLKRTLPKNIISLLHPSENRPQQIRSTTFVDGLNQASDIFNRRFKVTKPGLKRPL
WIDDPDGVRQRVESIISDAEVFLSRKDFIKQARTMQGSRDFGAQLFCALLRSVGVEARLV
CSLQPLSFRDKFKDTATPAPVSKSSENVTQPTAGESQMSQRSTVKRLARPRFTPVRRPGT
PTQSSPRPIRESSHPIFWIEAFNEAVNKWIPVDALVTKSMAKPSKFEPPANDPYNLLSYV
VAFEDDASVRDVTRRYAKAFNAKTHKHRVDSIGNHVNWWNKVLRFYEKPFLEDRDQLEIS
ELTAKTAAEPMPRNIQDFKDHPVYALERHLRRNEVVFPKRVIGQVSLGKSGSKNQVLEPV
YRRSDVHTLRSADRWYRLGRDIKPGEQPLKRVTSRRPQMGRLNDEEDDSISETPLYAYYQ
TQVYQPPPVVGGRIPKNMYGNLDVYVPSMVPLGGVHIAHPDARQAAKILAIDYADAVTGF
SFKGRHGTAILQGVVVATEYREALEEVLNGLEGEKLQAELDRKSAETLQAWKHLMLKMRI
AERVKGYVVEGERDADEPETNENVEDPEEFGGGFIPEPEQEANSSAAVMDWIGPSQGGPS
GPTGRDMSLSTTETDMLGGGFIPEESADQVSSPQQSSNITRLQRNSSALPRYDLVVTSKF
EPAGQAAPIQSFMGKHSGLLPDRTKEDLGHITPQIAPQNSEAAILRSTTTIPSSAHPRIV
VQAADSRSPTPGITSQETHSDEEASLLSQDPEDDDAIPEWLMSD
NT seq 2835 nt   +upstreamnt  +downstreamnt
atggcgagtcgtgggcccactactcgctccagaagagcgggagctgcttcgaaccattct
cggcggcagcgcgaagaccaggatcatgaaattccagcggtctaccgagaaatgctggct
gaggctgaaatcagagagacctccaggccagatgatagccaactacccaaaagaaggagg
attacccgtcccaatcctgtatctgactcccagcttgtacatcaagatgctgctatcacc
tcagaagccagccattctacagttcaacctgtgcaaacggtgtatgattcgccatcatca
tccgaagaatcaggtatggagtgggaagaggttgatattcagcaagctccgcagactagt
caagcggatgatacctcgattcaggtcacactgggtcggcccgaggatcagaagcgcaag
gtagttgctaagcgaagggggatcaccactgctgaaaagcagttgagattaagcatccat
aaagttcatctactttgccttctacgccatgtgcagatacgcaatctttggtgcaatgat
gaggaattacagggctttctcaaacggacattgccgaaaaatatcatctcactgttgcat
ccgtccgagaacaggccgcaacagatcaggtcaacaaccttcgttgacgggctgaaccaa
gctagtgatatattcaatagaaggtttaaggtaaccaagccagggctgaaacgacctttg
tggatagacgatcctgatggcgtcagacaacgagtggaatctataataagtgatgccgag
gtcttcctctcaaggaaggatttcatcaaacaagcgcgaacaatgcaaggttctcgtgac
tttggcgcccagttattctgtgctttgttacggtccgtgggcgttgaagcaagacttgtc
tgctcactgcagccattatcatttcgggacaaattcaaggatacggcaactcctgctcca
gtgtctaaatcttcagaaaatgttacccaaccaactgctggagaatcgcaaatgtcacaa
cgttcgactgtgaaaaggctagctcgaccacgcttcacaccagtcaggcgccctggaact
cctactcaaagttctccccggcctatccgtgaatcatcgcatcccatattctggattgaa
gcctttaacgaagcagtcaataaatggatacctgtcgatgctttggttaccaagtctatg
gcaaagccttctaaattcgagcctccagcaaacgatccttacaatcttctgagctacgtg
gtagcctttgaggatgatgcttctgttagagatgtcactaggcgctatgcgaaggctttc
aacgcaaaaactcacaaacaccgtgtggattccattgggaatcatgtcaattggtggaat
aaagtgctgcgcttttatgagaagccattcttggaagaccgggaccaactggagatcagc
gagctgactgccaagacagccgcagagcctatgccccggaatatccaagacttcaaggac
catcctgtctatgctcttgagaggcatcttcggcggaatgaggttgtctttcccaaacgg
gtgattgggcaggtgagccttggtaaatcagggtcaaagaatcaagtattggagcccgta
tatcgccgatcagatgtgcatactctacgtagtgcagatcgctggtatcgcctgggacga
gacatcaagccaggtgaacaaccattgaagcgtgtcacatcaaggaggccgcagatgggg
aggctcaatgacgaggaggatgactccatctccgagacacctctgtacgcttattatcag
acacaagtgtatcagcctccgccagtagttggagggagaatacccaagaatatgtatggg
aatctggatgtctatgtacctagcatggtacctctaggcggtgtccatatcgctcatcca
gatgctcgtcaagctgccaagattcttgctattgactatgcggatgctgtcactggtttc
agcttcaaggggcgccatgggaccgcgatactgcagggagttgttgttgccactgagtat
cgggaggcacttgaagaagtgctgaatggtctggaaggagagaagttacaggccgagtta
gataggaagtctgccgaaacactgcaggcttggaagcacttaatgctgaaaatgcgcatt
gcagagagagtcaaaggctatgttgtagaaggcgagcgagatgcagatgagccggagaca
aacgaaaacgtggaggacccagaagagttcggcggcggttttattccggagccggagcaa
gaggccaacagttcagctgctgtgatggactggattggtccctctcaagggggaccttca
ggacctacaggcagagacatgtctctctcgactacagagacggatatgctcggtgggggt
ttcattcctgaagaaagcgccgatcaggtgtcttcgcctcagcaaagcagcaacatcaca
agattgcaaaggaatagctcagcacttcctcgatatgatctggtcgtcacttcaaagttt
gaacctgcaggtcaggcagccccgattcaaagcttcatgggtaagcattcaggcttgctg
ccagacaggacgaaagaggacttggggcatatcacaccgcagattgctcctcagaactca
gaggcagcgatcctcagatctactacgacaattccgagctctgcacatccccggatcgtt
gtacaagcagctgattcgcgctccccaacccctggcatcaccagccaagaaacgcacagc
gacgaagaggcttctttattatcgcaagacccggaagatgatgatgccattccggagtgg
ttgatgtccgattaa

KEGG   Aspergillus niger: ANI_1_2430024
Entry
ANI_1_2430024     CDS       T01030                                 

Symbol
An02g03720
Name
(RefSeq) rad4 family protein
  KO
K10838  xeroderma pigmentosum group C-complementing protein
Organism
ang  Aspergillus niger
Pathway
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_2430024 (An02g03720)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_2430024 (An02g03720)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      ANI_1_2430024 (An02g03720)
SSDB
Motif
Pfam: Rad4 BHD_3 BHD_1 BHD_2 Transglut_core AbfS_sensor
Other DBs
NCBI-GeneID: 4978858
NCBI-ProteinID: XP_001399507
UniProt: A2QCI7
AA seq 932 aa
MPPYVPRKRLSSEDPPAAKRRHATPPIAAVIEDTDTESSLSDVPEETETPQALDGSDEES
SDSDEVDWEDAIESNANATPATPSILNPDQHQDLELTLDKNEIHLTDLLEGKKGPSKIER
QIRIQTHCLHVQFLLHHNAIRNVWANDTQLHEILRRKLPQPIHKEVKKWRIASGLEAPEP
PPEKKSKKGKGKQRRQSERDWAEGSSRLEPGQPDMSSGDPIIILLKVLAAYWKSKFKITA
PGLRKQGYRPMAQLEAQIKSFQKDDHDPEKHGERIASIEEFRQAAENMQGSRDVGAQLFT
ALLRALDIEARLVASLQPLGFGWTKSETYTTKPSADTEPSTENAETEDAIDVESDSSEDD
TKPARSKYFSKYDEDLPFPIYWTEVASPITHQIIPVDPLILRNPVATTPELQAAFEPRGG
KAEKAKQVICYVVAYSSDKTAKDVTTRYLRRRTWPGKTKGYRIPVEKIPIPGRKGKYYEV
DWFRVILRVYQRAQPQRTAVDDLEDTKDLLPNQPERKPGKEGDTLQSLRTSTEFVLERFL
RREEALKPGARHVRTFKTGKGAKAKEEKVFRRKDVLKCLSAESWHKEGRRPKAGEMPLKR
VPIRAVTLLRKREVDEFERQNGEKPKQGLYAIHQTEYIIPDPICDGVIPKNEYGNIDCFV
PSMVPRGAVHIPWPGTVRVCKKLGVDYAEAVTGFEFGSKMAVPVIQGVVVAAENEDLVKD
AWLVDDAEKRKREQRKAEARILQTWRKFLFGLRIKQRVQEEYGGNADDGVDHERDAHNPF
TNRRGRLPDPDASASASAPAPDEHDEEVHGGGFLLPGEDEDGADVDRGGGFLLPGQEGDD
HDDGGLIVDHHEQQQQHVPTEPATPEVVDAEIADSDDDDDGKVENPISLSSDSELSSPVE
IPDSEESDAESESEYEPEPRPTRRSTRRGGRR
NT seq 2799 nt   +upstreamnt  +downstreamnt
atgcccccatacgtcccccgaaagcgtctctcttccgaggatccgcccgccgccaaacgc
cgtcatgcgacgcctcccatcgccgccgtcatcgaagacactgacaccgaatcgtccctg
agcgatgttcccgaagagacggaaactccccaggcactggatggatcggatgaggaaagc
agcgactccgacgaggttgattgggaggacgccatcgagtccaatgccaacgccacccca
gccacgccttccatcctcaaccccgaccagcaccaggacctggagttgacactagacaag
aacgagatccacctcactgatctgctcgaagggaaaaagggcccgtcaaagatcgaacgc
caaatccgcatccaaacccattgtctacatgtgcagtttctgctccaccacaacgccatc
cgcaatgtctgggccaacgacacccagctccacgagatcctgcgccgcaagctaccccaa
cccatacacaaagaggtcaagaaatggcgcattgcatccggcctcgaggctccagagcca
ccgcccgagaagaagtcgaagaaaggaaaagggaagcagcgtcgtcaatcagaacgggat
tgggctgaaggctcgtcgcgacttgaacccggccaacctgacatgagcagcggtgacccc
attatcatccttctcaaggtcctcgctgcctactggaagagcaagttcaagatcaccgct
cctgggctacgtaagcaggggtatcgccccatggctcagttggaggctcagatcaagtcc
ttccagaaggacgaccacgatcccgagaaacacggcgaaagaatagccagcattgaggag
ttccgccaggctgccgagaacatgcagggctcgcgtgacgtaggcgcccagctgttcacg
gctctgctgcgtgctctcgacatcgaagctcgactagtcgccagtctgcagccccttggc
ttcggctggaccaagagcgaaacctacacaaccaagccaagcgcagacaccgagccatcg
acggagaatgcggaaaccgaagacgccattgacgtagagtcagacagcagtgaagacgac
acaaagcccgcccgtagcaagtacttcagcaaatacgacgaagacctgcccttccccatc
tactggaccgaagtcgcctctcccatcacccaccaaatcatccccgtcgacccgcttatc
ctccgcaaccctgtcgccaccacccccgagctccaagcagccttcgaacctcgcggcggc
aaagccgaaaaagccaagcaagttatctgctacgtcgtggcctactcgtccgataagact
gccaaagacgtgacaacacgctatctccgccgccgcacctggcctggcaaaaccaaaggc
taccggatccccgtcgagaagatccccataccaggccgcaaaggcaaatactacgaagtc
gactggttccgcgtaatcctccgcgtctaccaacgcgcccaacctcaacgcaccgccgtc
gacgacctcgaagacaccaaggacctcctcccaaaccaacccgaacgcaaacccggcaaa
gaaggtgacacgctccaaagcctgcgcacatccacggaattcgtcctcgaacgcttcctc
cggcgcgaagaagctctcaaacccggtgcgcgacatgtccgcaccttcaagacaggcaaa
ggggccaaagccaaagaagagaaagtcttccgacgcaaagacgtcctgaaatgtctatcc
gcagagagctggcacaaagaaggccgaagacccaaggctggcgagatgcccctgaaacgc
gtgcccatccgcgccgtcactctcctccgcaaacgcgaagtcgacgaattcgagcgccag
aacggcgaaaagccaaaacagggcctctacgccatccatcaaacggaatacatcattcca
gaccccatctgtgacggtgtcatacctaaaaacgaatacggcaatatcgactgcttcgtc
cctagcatggtgccccgcggtgcggtccatattccctggcctggaactgtgcgcgtatgc
aagaaactcggcgtcgattatgcagaagcagtcacaggcttcgagttcgggtcgaagatg
gctgtccctgttatccagggcgtggttgtcgctgcggaaaacgaggacctcgttaaagat
gcctggttagtggatgacgcagagaaacgtaagcgggagcagcgcaaagccgaggcgcgt
attctgcagacttggcggaagtttctcttcgggttgcggattaagcagcgtgtacaggag
gagtatggtgggaatgcggacgacggggtggatcatgagcgtgatgctcataatccgttt
acaaatcgtcgtggtcgtttgcctgatccagatgcttctgcttctgcttctgcccctgct
ccggatgagcacgacgaggaagtccatggtggcgggttcctacttcctggtgaggatgag
gacggggcggatgtagatcggggcggtggattccttcttcctgggcaggagggagatgat
catgatgatgggggattgattgttgatcatcatgagcaacagcagcagcatgtaccgact
gagcctgccacaccggaggttgttgatgcggagattgctgatagtgatgacgatgacgat
ggcaaggtggagaatccgatctcgttaagttctgactcggagctctcgtctcccgtagag
ataccggattcagaggagtcagatgcagagtccgagtcggaatatgagccggagccgcgg
ccgacgcggagaagtacgaggaggggtggtcgtcgatag

DBGET integrated database retrieval system