KEGG   Aspergillus niger: ANI_1_150114
Entry
ANI_1_150114      CDS       T01030                                 

Symbol
An13g01060
Name
(RefSeq) DNA mismatch repair protein MSH3
  KO
K08736  DNA mismatch repair protein MSH3
Organism
ang  Aspergillus niger
Pathway
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    ANI_1_150114 (An13g01060)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_150114 (An13g01060)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     ANI_1_150114 (An13g01060)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV DUF4911 AIB
Other DBs
NCBI-GeneID: 4986554
NCBI-ProteinID: XP_001396245
AA seq 1118 aa
MPLPSSQNSSSPGVKRKQSTLASFFTKKPQTAQQASVNVVEEKSPAATFDKADNQERAAK
KDKALTDDEEDDIVAPAPKRVRTNGLYPASREEIPNSTSTTERPPALTSSQRTERFKFSS
SPAVNTGVEGSQAAVELEAGQRQKEREELHHKFVRKLGGADCLIGIGRNAISEATPEEGA
EPEDEEEAAPPPPAKGKAAAKKGGSKLTPMEKQVIDIKRKHMDTVLVVEVGYKFRFFGED
ARVAAKELSIVCIPGKLRFDEHPSEAHLDRFASASIPVHRLHVHVKRLVAAGHKVGVVRQ
IETAALKAAGDNRNAPFVRKLTNLYTKGTYIDDAEGLGGPMPAASGGASPATGYLLCITE
TNAKGWGNDEKVQVGIVAVQPATGDIVYDDFEDGFMRSEIETRLLHIAPCELLIVGELSK
ATEKLVQHLSGSKLNVFGDKTRVERVLKSKTAAAESHSHVSSFYAGKMKTASAADDAQAS
SLLQKVLNLPEQVTICLSSMIEHMKEYGLEYVFELTKYFQHFSSRSHMLLNGNTLMSLEI
YQNQTDHTTKGSLFWTLDRTQTRFGQRMLRKWVGRPLLDKSRLEERVNAVEELKNPEKTV
MVERLKGLLGKVKSDLEKSLIRIYYGKCTRPELLTVLQTMQMIAQEFSDVKSPADTGFAS
TAINEAITCLPTILEDVVAFLDKINMHAAKSDDKYAFFREAEETEDISDQKLGIASVEHE
LEEHRSVAGQKLGKKTVEYKSVAGIDYLIEVENSSASIKRVPASWVKVSGTKKVSRFHTP
EVIQLMRQRDQHKEALAAACDQAFISLLADIATKYQPFRDSVQALATLDCLIALATIASQ
PGYVKPEYTDHTCIQVDQGRHPMVEQLLLDSYVPNDIDLDSDKTRALLVTGPNMGGKSSY
VRQVALIAIMGQIGSYVPAQSAKLGMLDAVFTRMGAFDNMLAGESTFMVELSETADILKQ
ATPRSLVILDELGRGTSTHDGVAIAQAVLDYMVRSIRSLTLFITHYQHLSSMVHSFADQE
LRNVHMRFTESGTGTDEEITFLYEVGEGVAHRSYGLNVARLANLPGALLDQARQKSKELE
EKIRRRKLAGLVTAVGEVIEGSKDENMIERLISSAEQL
NT seq 3357 nt   +upstreamnt  +downstreamnt
atgccccttccctcatcacagaattcttcgtcaccgggggtgaagcggaaacagtcaacg
ctcgcgagcttcttcacgaagaaaccacaaacagcccagcaagcttcagtcaatgtcgtt
gaagagaaaagcccagctgcaacttttgataaagcggacaatcaggaacgagcggcaaag
aaagataaagccctgaccgatgatgaggaggatgacatagtcgcaccggctcctaaaaga
gttagaacgaacggcctttatcccgcaagcagagaagagattccgaattcaacatcaact
acagagcgacccccggccctgaccagtagccaaagaactgaaagatttaagttcagcagc
tcaccagcggtgaatactggagtggaagggtcacaggcggcagttgaactcgaggctgga
caaagacagaaggagagagaagagttacaccacaagttcgttcggaagttgggtggcgcg
gactgcctcattggcattggtagaaatgccattagcgaagctacgcccgaagagggtgct
gagcctgaagatgaggaggaagcagcaccaccccctcctgctaagggcaaagctgccgcg
aagaaaggcggaagcaagctcactccaatggagaagcaggtcatcgacataaagcgcaag
catatggatacagtcctagtagttgaagttggctataagttccgattctttggtgaagat
gcgagggtcgccgcaaaggaattgtctattgtctgtatcccagggaaactgagatttgac
gaacatccttctgaagcacacctcgatcgtttcgcctccgctagcataccagtccacaga
ttacatgttcatgtaaagcgcctcgttgctgcaggtcataaggtcggcgttgtgagacaa
atagagaccgctgctctgaaagcagcgggcgacaaccgtaacgcgcccttcgtgcgcaaa
ctcacaaatttgtacaccaagggtacctacattgacgatgcggagggcttaggagggcct
atgcctgcagcatctggcggcgcctcaccagcaaccggctacttgctatgtataactgaa
acaaatgcaaagggctggggcaatgacgagaaggttcaagtgggaattgttgctgtccag
ccagctacaggagacatagtctatgacgattttgaagatgggttcatgagaagcgagatc
gaaacgaggttgctgcatattgcaccctgtgagcttttgattgttggcgagctttccaag
gctacggagaagctcgttcagcatctttctggcagcaagttgaacgtcttcggagacaag
acccgcgtggaaagagtacttaagtcgaaaactgccgccgcagagtcacacagccacgtc
tccagcttttatgcaggaaaaatgaagacggccagtgctgcagatgacgcgcaggcgagt
agcctacttcagaaggtgctcaatctgccagagcaagtgaccatttgcctctcgtccatg
atcgagcacatgaaagagtacggcttggaatatgttttcgagttgacaaaatacttccaa
cacttttcctcccgatcacacatgcttctgaatgggaacactctcatgagccttgagatc
taccaaaatcaaacggaccatacgactaaaggcagtctcttctggacgcttgatcggacg
caaacgcggttcggacagcgcatgctccggaaatgggtcggacgtcctctgctagacaag
tcgaggctggaggagagggtgaacgccgtcgaagagctgaagaatccagaaaagacggta
atggtagagcggctcaagggtctgcttggaaaggtcaagagcgacttggaaaagagcttg
atccggatctattacggcaagtgtactcgaccggaactcctcaccgttttgcagacgatg
caaatgattgcgcaggagttttctgacgtgaaatcacctgcggataccggttttgcatct
actgccatcaatgaggcgatcacttgtctccctacgatcctggaagatgttgtagcattt
ctggacaagataaatatgcatgctgcgaagagtgatgataaatatgccttcttccgggaa
gccgaggagacagaagatatcagcgaccaaaagctcggcattgcaagtgtggaacacgag
ctagaggagcatcgctctgttgctggccagaagcttgggaagaagacggtcgaatacaag
tctgttgcggggattgattatttgattgaagtcgagaacagctcggcttccatcaaacgt
gtccctgcatcgtgggtgaaagtgagcggcaccaagaaagtttcaaggtttcacacgccg
gaagtcatccaactcatgcgacagcgtgaccaacataaagaagcgttggccgcggcgtgt
gaccaggctttcatatcccttctcgctgatatagcaactaaataccagcccttcagggat
agtgtgcaggcattggccacgcttgactgcctgatagctctggcgactatagctagtcaa
ccgggatatgtgaagcccgaatatacggaccatacgtgcatccaagtagaccagggacgt
catccaatggtcgaacagctactgctggacagctatgtaccaaacgacatcgacctggac
agcgacaagacacgcgctcttctggttaccggacccaacatgggcggcaagtccagctat
gtacggcaagtagcccttattgccatcatggggcaaataggctcttatgttcccgcgcag
tctgccaagcttggtatgttggacgctgtttttacacgcatgggtgctttcgacaacatg
ctagctggcgagtctaccttcatggttgagctttccgaaaccgcagacatactcaagcaa
gcgactccacggtcacttgttattctggatgaactgggccggggtacgtcaacccatgat
ggcgttgcaattgcacaagctgtccttgactacatggtacggtcgattcgaagccttacc
ctcttcatcacgcattatcaacacctctcttcaatggtccattccttcgcagaccaagaa
ttacgcaacgtgcacatgcgcttcactgagtcgggtaccggaacagacgaagagatcaca
ttcctctatgaggtaggtgaaggcgtggcacaccgcagctacgggctgaatgtcgcgcgg
ttagcaaacctgccaggggcattgctggaccaagcccggcagaagagtaaagaattggag
gagaaaatccgccggcggaaactggctggtcttgtgacggccgtcggagaggtcattgaa
ggctccaaggatgaaaatatgattgagcgcctcatcagcagcgcagagcagctgtag

DBGET integrated database retrieval system