KEGG   Aspergillus niger: ANI_1_1544184
Entry
ANI_1_1544184     CDS       T01030                                 

Symbol
An04g00580
Name
(RefSeq) mating-type switch/DNA repair protein Swi10/Rad10
  KO
K10849  DNA excision repair protein ERCC-1
Organism
ang  Aspergillus niger
Pathway
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_1544184 (An04g00580)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_1544184 (An04g00580)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     ANI_1_1544184 (An04g00580)
SSDB
Motif
Pfam: Rad10 HHH_5 HHH HHH_2
Other DBs
NCBI-GeneID: 4990459
NCBI-ProteinID: XP_001401422
UniProt: A2QHP4
AA seq 327 aa
MDPVARSESATPRASGASTPQPPSKVQQPKPQALPSRSGPSAILVSTRQKGNPILNHIKL
LPWEYADIPADYVVGNTTCALFLSLKYHRLHPEYIYSRIRLIAGKYLLRIILVIVDIPNH
EESLKELSKTSIVNNLTLILCWSAPEAAHYLELFKSSENSQPIAIRTQQAQSYKESLVEF
VTTPRSINKSDAASLISTFGSLQNAVNAQPEQISAVPGWGEKKVRQWCTTVREGFRAESA
KRVTARGGIARGHATGVVEDHGDRTFNSLETSEDNAAESILADAEEGRLETRRQAIEERR
LQESSQQEEEMSEGIMAALAKYRQDGG
NT seq 984 nt   +upstreamnt  +downstreamnt
atggacccagtagcacgttcagaatctgctacgccccgagcgtctggtgcctcgacgccg
cagccaccgtctaaagtccagcagcctaagccacaagcactccccagcaggtctggtcca
tctgccatcctcgtgtcaacgcgacaaaaaggcaatccgatattgaatcacatcaaactg
ctgccatgggaatatgcagatattccggccgactatgtggtcggaaataccacctgtgct
ctatttctttccttgaagtaccaccggttacatcccgaatatatctactcgcgaattcgt
ctcatagcaggaaaataccttttacgtattatcctggttattgtggatatcccgaatcat
gaagaaagcttgaaggagctttcgaagacatccatcgtcaataacttgacgctgatcctt
tgctggtctgcacccgaagctgcacactatcttgaattgttcaagtcttctgaaaactct
caacctattgctattcgcacgcagcaagctcagtcatacaaggaatctcttgttgagttc
gtcacgacaccccgaagcattaataaatcagatgcagcaagcttgatatctacgtttggg
agcctgcagaatgcggttaatgcccaaccagagcagatcagtgcagtacccggatggggt
gagaagaaggtcaggcagtggtgtactacagtaagagaaggctttagggccgagtcggcg
aagagggtaactgccaggggaggaatcgctagaggtcatgcaaccggggttgttgaggat
catggagaccgaaccttcaattctttggaaacaagtgaagacaacgccgcagaatcaatc
ctagcagatgcagaggagggtcggctagaaacacggagacaagctatcgaagagcgacga
ttgcaggagtcgagtcagcaggaggaagagatgagtgagggcatcatggcggctctggcg
aagtatcgacaggacggcggttga

DBGET integrated database retrieval system