KEGG   Aspergillus niger: ANI_1_1576084
Entry
ANI_1_1576084     CDS       T01030                                 

Symbol
An09g06810
Name
(RefSeq) TFIIH basal transcription factor complex p47 subunit
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
ang  Aspergillus niger
Pathway
ang03022  Basal transcription factors
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    ANI_1_1576084 (An09g06810)
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_1576084 (An09g06810)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ang03021]
    ANI_1_1576084 (An09g06810)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_1576084 (An09g06810)
Transcription machinery [BR:ang03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ANI_1_1576084 (An09g06810)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     ANI_1_1576084 (An09g06810)
SSDB
Motif
Pfam: Ssl1 C1_4 VWA_2 VWA Tfb4
Other DBs
NCBI-GeneID: 4984218
NCBI-ProteinID: XP_001393996
UniProt: A2QUU4
AA seq 457 aa
MVDSDEEYIGEISEDEDENNLLPGSRGETTSASRSKRRKHRGGAEWEVSRTWETLVEGAD
GTISSTVEGLLEAGKRKRLLRDTTPLQRGIIRHLILIIDLSQSMTEKDLRPTRYLLSLRY
AQEFVREFFEQNPISQLGVLGLKDGLAVRVSDMSGNPTEHISAIQSLRDQDPKGLPSLQN
GFEMARGALFHTPSHGTREIFVIFGSLLSSDPGDIHQTITTLINDKIRVGIVGLAAQVAI
CREICGKTNGGDDTTYGVALNEQHFRDLVMNVTTPPATYSQKQSTSSLLMMGFPSRTVEA
YPSLCACHSKPSRGGYLCSRCNSKVCGLPAECPSCGLTLILSTHLARSYHHLFPLMNWVE
VSWQHASRSSVCFACGISFPSVPPKEQWHTTEGQTKGISVSSRYECTVCRNHFCIDCDLF
AHEVVHNCPGCQSKMIVATSSEPSQDHEALDRMDTSA
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggtcgattccgatgaagagtacataggagaaatctctgaggatgaggatgaaaacaat
cttctaccagggtctcgcggagagactacgtccgcatcccgctccaagaggagaaagcac
cgtggaggcgcagaatgggaggtctcgagaacatgggaaaccttagttgaaggtgccgac
ggtacaatcagctctacagttgaagggcttctcgaggctgggaaaaggaaaaggctcctc
agagatacgactcctttacaacggggtataatccgtcatctcatcttgattatagatctg
tcacaatctatgaccgagaaagatctccgaccgacacgttacttattgtccttacggtat
gcacaagagttcgtgagggaatttttcgagcaaaatcccatctctcaactcggcgttctt
ggcctcaaagatggactggcggtcagagtcagtgatatgagtggaaaccctactgagcat
attagtgccatccaatcactgcgagaccaggatccgaaaggtcttcctagtctgcaaaat
ggcttcgaaatggctcgtggtgccttgttccatactccaagccatggcacccgtgagatc
ttcgtcatttttggctccctcctttcctctgatcccggtgatattcaccaaacaattact
acgcttataaatgataaaatacgtgttggaatcgtgggccttgctgctcaagtggcaatc
tgtcgcgaaatttgtggcaagactaacgggggcgacgataccacatacggtgtagcactc
aatgaacaacatttccgtgaccttgtgatgaatgtgacaacaccaccagccacatactct
cagaagcagtccacaagctctctcttgatgatgggttttccatcacgaaccgttgaggct
tacccttcactttgtgcatgccattccaagccttctcgtgggggctatctgtgctcacgg
tgcaacagcaaggtttgtggtctccctgccgagtgtccttcctgtggtcttactttgatt
ctttcaacccatcttgctcggtcgtatcaccatctgtttccccttatgaactgggtggaa
gtttcgtggcaacacgcttcacgcagtagtgtctgtttcgcttgtgggatatcctttcca
tcagtaccacccaaggagcagtggcatactacagagggacaaacaaagggaataagcgta
agcagccgctatgaatgtactgtttgcagaaaccatttttgcattgactgtgaccttttc
gctcatgaggttgtgcacaactgccctggctgccaaagcaagatgatagttgccacgagt
tctgagccctctcaggaccacgaagctctagacaggatggatacctctgcatga

DBGET integrated database retrieval system