KEGG   Aspergillus niger: ANI_1_1586144
Entry
ANI_1_1586144     CDS       T01030                                 

Symbol
An16g02590
Name
(RefSeq) exonuclease
  KO
K10746  exonuclease 1 [EC:3.1.-.-]
Organism
ang  Aspergillus niger
Pathway
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    ANI_1_1586144 (An16g02590)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_1586144 (An16g02590)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_1586144 (An16g02590)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     ANI_1_1586144 (An16g02590)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    ANI_1_1586144 (An16g02590)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     ANI_1_1586144 (An16g02590)
SSDB
Motif
Pfam: XPG_I XPG_N XPG_I_2
Other DBs
NCBI-GeneID: 4988652
NCBI-ProteinID: XP_001397572
UniProt: A2R780
AA seq 758 aa
MGIKGLHGLLKSIQKPCHLKKFSGQTLGIDAYGWLHRGTVACAVDLVLERPTRKHIDFVL
NRVRMLLYFGVTPYLVFDGDELPSKAGTEVERQKRRQDSKALGLELQRKGRIAEAYQELQ
KAVDVTPLMARELIEELKKINVQYVVAPYEADAQLAYLERQGVISGIISEDSDLLVFGAK
RLLSKLDQHGDCIEINRADFSACREVSLIGWTDDDFRRMCILSGCDYLPNIARLGLKTAY
RSIRKYKNVERALRMLQFDGQYHVPSDYLDNFRQAELTFLYQRVFCPKAGKLVTLTPPEA
EIILEDLTFIGGDVEPDIAVGVARGDLDPTTKEPLVLKPSLAAKPADKRLTNTISRRQTL
GSSAELKPNKPINSFFTPKRVPLAELDPNSLSPSPSQQRLLQRHANSSWDSVPAPSRPAL
IRSASSVGSSNRASSPLIRSVERNAFLAHASRTSNLQPAKRQRLCSDAEEANLPNPPDCR
SRFFSGSVDDSSPSAQKATRTKKARKSTLDVFSDDSAEDLMTQLPDPSHATETPRVEIQI
IGDNNSSISGRSIQTPAAATSGSGASESPAANCKDPTEKQSFSTAEQASEKRSNAVDDSP
TPDLVPNANSATLSKYVFQAGNVSVSPRNDKHGGKGHQSGSLDEHMVPTGVRHGLLGHSP
RRQRTTPLQRLGQSALARSRSLNCVSPSLAAFRASETPTKSPAVAKLDSNPVRSLATPSQ
GSEDMIIPDSEDEESEGETQAPVGLASFDVRRFSFMGK
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgggcattaaagggcttcatggcctgctcaaatccatacaaaaaccgtgtcacctcaaa
aagttcagtgggcagaccctgggaatcgatgcatatggatggctacatcgaggcaccgtc
gcctgcgcggtggacttggttttggaaaggcctactaggaaacatatcgatttcgtctta
aaccgagtccgcatgctcctctacttcggggtgacaccatatcttgttttcgacggcgat
gagctgccgagcaaggctggtaccgaggtggagcgtcaaaagagacggcaggacagcaaa
gccctcggcttggaactccagcgaaaggggcggattgcagaggcataccaggaactgcag
aaggccgtcgacgtgacgcccttgatggcccgggagttaatagaggagctgaagaagata
aacgtccaatacgtcgtggctccgtacgaggcagacgcacaactggcttatctggaacga
caaggcgttatctctggtatcatttcagaggattctgatctgctcgtctttggcgcaaaa
cggttgttgtccaagctcgaccaacatggcgactgtattgagatcaatcgtgctgacttc
tcggcctgtcgagaggtaagtctgatcggatggaccgatgatgactttcgacggatgtgc
attctcagtggctgcgattatcttcccaatattgcacggctagggttgaagacagcctac
cgaagcattcgaaagtacaagaacgtagaacgggcgttgcggatgcttcagttcgacggt
caataccacgttccctctgattacctggacaacttcagacaggcagagcttacgtttctt
tatcagagagttttctgtccgaaagctgggaaactggttacccttacacctcctgaggcc
gaaataattctagaagatctcacatttatcggtggtgacgtggaacctgacattgcggtc
ggagttgcgcgtggtgatttggacccaacgaccaaggaacctcttgtactaaagccatcg
ctcgcagctaaaccggccgataagaggctgaccaacacgataagtcgtcgacagaccctg
ggctcgtctgctgaactcaagccaaacaagcccattaattccttcttcacccccaagcgc
gttcctctggcagagttggacccgaatagcctcagtccctctcccagccaacaacggctg
ctacaacgtcatgccaacagctcttgggacagtgttccggcgccatcacggccagcactc
ataagatctgcgtcatcagtcggatcgtcaaatcgggcttctagccctttgattagaagt
gtggagcgtaatgccttcctggcacacgcctccagaacatcgaatttgcagcccgctaag
cggcagcgactatgttctgatgcagaggaagccaacctccccaatccgccggattgccgc
agcagattcttctccggtagtgttgacgattctagtccaagtgcacagaaggccacccgc
acaaagaaggctcgaaagtctaccttggacgttttctcggatgactctgcagaagacctc
atgacacagctaccagacccgagccacgcgactgaaacccctagagttgagatacagata
attggtgataataattcatccatcagtggcaggtccattcagacgcctgccgcagctact
tctgggtccggtgcttctgaatcgcctgcggcaaactgcaaagacccaaccgagaagcag
agtttttccactgctgaacaagcttcggagaagagatcgaatgctgtcgacgacagtcct
acaccagaccttgtgcctaatgcaaactctgcgacgctttcaaagtacgtcttccaggcc
ggaaatgtttctgtgagtcctcgaaatgataagcatggtggtaagggccaccagtcgggt
tccttggatgagcacatggtgcctacaggggtgcggcacggcttgttgggccactctccc
agacgtcagcggacgacaccattgcaacggctgggccaaagcgccttggctcggtctcga
tcactcaattgtgtttctccctccctggcagcatttagagcttcagaaacaccgacaaag
agccctgcagttgcaaagcttgactccaacccagtgcgaagtctggcaacacccagtcaa
ggcagtgaagacatgattattccggatagtgaagatgaagaatccgagggcgagacccaa
gccccagtgggacttgcctcatttgatgtgcgacgattctcgtttatgggtaaatag

DBGET integrated database retrieval system