KEGG   Aspergillus niger: ANI_1_166084
Entry
ANI_1_166084      CDS       T01030                                 

Symbol
An09g01660
Name
(RefSeq) RNA polymerase II transcription factor B subunit 5
  KO
K10845  TFIIH basal transcription factor complex TTD-A subunit
Organism
ang  Aspergillus niger
Pathway
ang03022  Basal transcription factors
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    ANI_1_166084 (An09g01660)
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_166084 (An09g01660)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ang03021]
    ANI_1_166084 (An09g01660)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_166084 (An09g01660)
Transcription machinery [BR:ang03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ANI_1_166084 (An09g01660)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     ANI_1_166084 (An09g01660)
SSDB
Motif
Pfam: Tfb5
Other DBs
NCBI-GeneID: 4983697
NCBI-ProteinID: XP_001393483
AA seq 72 aa
MPRAVRGVLIECDPSVKAIILKYDEERHDYIVEDLDDDRHLVIKESQLQNLKARLTKELD
DKVMQPDESESE
NT seq 219 nt   +upstreamnt  +downstreamnt
atgcctcgtgccgtcagaggagtcctcatcgagtgcgatccgtccgtgaaagccattatt
ctcaagtacgacgaagaaagacacgactatatcgttgaagacctcgacgatgaccgtcat
ctggtcatcaaggagagccagctgcagaacctgaaggcgaggttgacaaaggagcttgac
gataaggttatgcagcctgatgaatcggagtcggagtga

DBGET integrated database retrieval system