KEGG   Aspergillus niger: ANI_1_1662024
Entry
ANI_1_1662024     CDS       T01030                                 

Symbol
An02g11980
Name
(RefSeq) replication factor C subunit 2
  KO
K10755  replication factor C subunit 2/4
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_1662024 (An02g11980)
   03420 Nucleotide excision repair
    ANI_1_1662024 (An02g11980)
   03430 Mismatch repair
    ANI_1_1662024 (An02g11980)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_1662024 (An02g11980)
   03036 Chromosome and associated proteins [BR:ang03036]
    ANI_1_1662024 (An02g11980)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_1662024 (An02g11980)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    ANI_1_1662024 (An02g11980)
  DNA Replication Termination Factors
   ELG1-RFC complex
    ANI_1_1662024 (An02g11980)
Chromosome and associated proteins [BR:ang03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    ANI_1_1662024 (An02g11980)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     ANI_1_1662024 (An02g11980)
  Check point factors
   HRAD17(Rad24)-RFC complex
    ANI_1_1662024 (An02g11980)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 RuvB_N AAA_22 AAA_16 AAA_11 AAA_assoc_2 Mg_chelatase AAA_19 AAA_14 AAA_5 DUF2075 AAA_24 AAA_7 ResIII DUF815 AAA_30 AAA_18 AAA_23 bpMoxR AAA_28 DEAD DNA_pol3_delta KNTase_C RNA_helicase
Other DBs
NCBI-GeneID: 4979735
NCBI-ProteinID: XP_001400326
AA seq 389 aa
MAANFFNNKARAAAAAANPSKPKPTDNKEEQAKQQPWVEKYRPKTLDDVAAQDHTTKVLQ
RTLQASNLPHMLFYGPPGTGKTSTILALAKSLFGPSLYRSRILELNASDERGIGIVREKI
KNFARAQLTHSTGLGEEYLAQYPCPPFKIIILDEADSMTQDAQSALRRTMEQYSRITRFC
LVCNYVTRIIEPLASRCSKFRFKALDNTAAGERLEHIAKVENLRLEDGVVDKLIACSEGD
MRRAITYMQSAAKLVGAGRAGKKDEDEDEEMTDQESEVITVRTIEEIAGVVPESVLDALV
QAMQPKKIGSSYEAVAKVVTDIIADGWSATQLLLQLYRRVVFNDAIPDIQKNKIVMVFSD
MDRRLVDGADEHLSILDVALKISGILGGA
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggctgccaatttcttcaacaacaaggcccgcgctgctgcggcagcagcgaacccttcg
aagccgaagcccacagataacaaggaagaacaagcaaagcaacaaccatgggttgagaaa
taccgtcccaagaccctcgatgatgtcgccgcccaagatcacacaaccaaagtccttcaa
cgaacactccaagcttccaacctcccccacatgctcttctacggacccccaggtaccgga
aaaacatccaccattctcgccctcgccaaatccctcttcggaccttccctctaccgctcg
cgcattctggaactgaacgcctccgacgaacgaggtatcggtatcgtgcgtgaaaagatt
aagaactttgcccgtgctcaactcacacactctacggggttgggtgaggaatacttggca
caatacccgtgcccgccatttaagattattattctcgatgaggcggacagcatgacgcag
gatgcgcagtctgcgttgcgtcgcacgatggagcagtatagtcggattacccgtttctgc
ttagtttgcaactacgtcacgcgaatcattgagccgctggcgagtcgatgcagcaagttt
cgattcaaggctttggataacacggccgctggagagagattggaacatattgccaaggtg
gagaatctaaggttggaggatggagttgtggataagttgattgcttgcagtgagggtgat
atgcgacgggcgattacgtatatgcagagtgcggctaagcttgtcggggctggccgggct
gggaagaaggacgaggacgaggacgaggagatgacagaccaggagtcggaggtgattact
gttcggacaattgaggagattgctggtgttgttccggaaagtgtattggatgcgttggtg
caggcgatgcagccgaagaagatcgggtcctcgtatgaggctgttgcgaaggtggttacg
gatatcattgctgatgggtggagtgcaacgcagcttcttttacagttgtatcgacgggtg
gtgttcaacgacgcgatccctgatatccagaagaacaaaatcgttatggtgttctcggat
atggatcgacgtctggttgatggtgcagacgagcatctgtctatcttggatgtggccctt
aagatctctggcatcctgggaggagcttag

KEGG   Aspergillus niger: ANI_1_210144
Entry
ANI_1_210144      CDS       T01030                                 

Symbol
An16g01580
Name
(RefSeq) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_210144 (An16g01580)
   03420 Nucleotide excision repair
    ANI_1_210144 (An16g01580)
   03430 Mismatch repair
    ANI_1_210144 (An16g01580)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_210144 (An16g01580)
   03036 Chromosome and associated proteins [BR:ang03036]
    ANI_1_210144 (An16g01580)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_210144 (An16g01580)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    ANI_1_210144 (An16g01580)
  DNA Replication Termination Factors
   ELG1-RFC complex
    ANI_1_210144 (An16g01580)
Chromosome and associated proteins [BR:ang03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    ANI_1_210144 (An16g01580)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     ANI_1_210144 (An16g01580)
  Check point factors
   HRAD17(Rad24)-RFC complex
    ANI_1_210144 (An16g01580)
SSDB
Motif
Pfam: AAA Rep_fac_C DNA_pol3_delta2 Rad17 AAA_assoc_2 AAA_11 AAA_22 AAA_30 AAA_16 AAA_19 AAA_24 DNA_pol3_delta RuvB_N AAA_5 DUF815 AAA_3 ResIII AAA_14 PhoH Sigma54_activat DUF2075 Mg_chelatase DEAD AAA_18 TniB bpMoxR AAA_28 AAA_7 IstB_IS21 AAA_25 RNA_helicase NACHT ATPase_2 SRP54 ABC_tran
Other DBs
NCBI-GeneID: 4988551
NCBI-ProteinID: XP_001397471
AA seq 396 aa
MSDYEDSMDVDVPSKSAIQFSSDNTSGKAKRVAADLPVEAQDNLPWVEKYRPNTLEDVSG
HQDILATINKFVEANRLPHLLLYGPPGTGKTSTILALARRIYGAKNMRQMVLELNASDDR
GIDVVREQIKTFASTKQIFSMAPSSTSTSSSTLASYKLIILDEADAMTATAQMALRRIME
KYTANTRFCIIANYTHKLSPALLSRCTRFRFSPLKEADIRVLVDIVIEKEQVNIQPEAVD
SLVRLSKGDMRRALNVLQACFASSIPLPMKNAPKDQEAKEKPEAEVITNETIYDCIAAPH
PSDIEEIMTTLLATSDVTSCLSTINTLKANKGLALADILAALGDQLQRLEVPAQTRVTWL
EGLAEIEWRLAGGGSESMQTGGLVGVVRNGCELMGK
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgtccgactacgaggactcaatggacgtggacgtcccctccaagagcgcaattcaattc
agctccgacaacacaagtggaaaggcaaagcgagtagcagcagatttgcccgttgaagct
caagataacctgccttgggtagagaaataccgccccaacaccctagaagatgtatccggc
caccaagacatcctcgcaacaatcaacaaattcgtcgaagcaaaccgcctcccccacctc
ctcctctacggccccccaggaacgggcaaaacatccaccatcctcgccctagcccgccga
atctacggcgcaaagaacatgcgccaaatggtactggaactaaacgctagtgacgatcgc
ggtatcgacgtcgttcgagaacaaatcaagacctttgccagcacaaaacagattttctcc
atggcaccctcatccacctccacctcctcctcgaccctcgcctcctacaaactcatcatt
ctcgacgaagccgacgccatgaccgcaacggcccaaatggctctccgtcgcatcatggag
aaatacacagccaacacgcggttctgcataatcgccaactacacacacaagctctctccg
gcactcttgtcccgatgtacacgattccggttcagcccgctgaaagaggcagatatccgg
gtattagtggacatagtgattgagaaggaacaagtgaatatccagccggaggcggtggat
agtctggtgcggttgagtaagggagatatgcgacgggcgttgaatgtgctgcaggcttgt
tttgcgagtagtataccgttgccgatgaagaatgccccgaaagatcaggaagctaaggag
aagccggaggcggaggttatcacgaacgagacgatatatgattgcattgctgcgcctcat
ccgtcggatatcgaggagattatgacgacgttgttggcgacgagtgatgttacttcgtgt
ttgagtacgattaatacgctcaaggcgaataaggggttggccttggcggatattcttgct
gcgcttggggatcagttgcagaggctggaggtgccggcgcagacgagagtgacgtggttg
gaagggttggcggagattgagtggcggttggccgggggaggatcggagtcgatgcagacg
ggagggttggtgggtgttgtgaggaatgggtgtgagttgatggggaaatag

KEGG   Aspergillus niger: ANI_1_52134
Entry
ANI_1_52134       CDS       T01030                                 

Symbol
An15g00270
Name
(RefSeq) replication factor C subunit 4
  KO
K10755  replication factor C subunit 2/4
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_52134 (An15g00270)
   03420 Nucleotide excision repair
    ANI_1_52134 (An15g00270)
   03430 Mismatch repair
    ANI_1_52134 (An15g00270)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_52134 (An15g00270)
   03036 Chromosome and associated proteins [BR:ang03036]
    ANI_1_52134 (An15g00270)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_52134 (An15g00270)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    ANI_1_52134 (An15g00270)
  DNA Replication Termination Factors
   ELG1-RFC complex
    ANI_1_52134 (An15g00270)
Chromosome and associated proteins [BR:ang03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    ANI_1_52134 (An15g00270)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     ANI_1_52134 (An15g00270)
  Check point factors
   HRAD17(Rad24)-RFC complex
    ANI_1_52134 (An15g00270)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_14 AAA_16 Viral_helicase1 AAA_22 RuvB_N AAA_3 DNA_pol3_delta Mg_chelatase AAA_11 MeaB Rad17 AAA_19 NTPase_1 AAA_24 DEAD AAA_assoc_2 KTI12 AAA_25 AAA_30
Other DBs
NCBI-GeneID: 4987613
NCBI-ProteinID: XP_001396566
UniProt: A2R4F8
AA seq 352 aa
MVQAESSASASRNGLKAHTAGAPPDYELPWVEKYRPVYLDDIVGNTETVERLKIIAKDGN
MPHVIISGMPGIGKTTSILCLARQLLGDAYKEAVLELNASDERGIDVVRNRIKGFAQKKV
TLPPGRHKLVILDEADSMTSGAQQALRRTMEIYSSTTRFAFACNQSNKIIEPIQSRCAIL
RYARLTDAQIVKRLKQVCDAEKVEHNEEGIAALVFSAEGDMRQAINNLQSTWSGFGFVSG
DNVFRVVDSPHPIKVQAMIKACWEGKVDAALETLNELWELGYSSHDIISTMFRVTKTIPT
LSEHSKLEFIREIGFTHMRILDGVQSLLQLSGCVAKLCRINMKPQLFEPPKN
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggttcaagccgaatcctcagccagtgcctctcgtaatggcctcaaggcgcatacggcc
ggcgcccctcctgactatgaactgccctgggtagagaaatatcgcccggtatatctcgat
gatattgttggaaacacagaaacagttgagcgcttgaagatcatcgctaaggatggaaac
atgccgcacgttatcatctcgggcatgcccggtattggaaagactacttcgatcttgtgc
ttggcgagacagctactgggagacgcatataaggaggcggttctggagctcaatgctagt
gatgaaagaggtatcgacgtggtacggaaccggatcaaaggctttgcgcagaagaaggtc
actttgccgcctggtcgtcataagcttgtcatccttgatgaggcagatagtatgacatca
ggtgcccagcaagctttgcggcgtacaatggagatttactcgtcgactacacggttcgcg
ttcgcctgtaatcagtcaaataaaatcatcgagccgattcagtcgcgatgcgctatccta
cgttatgctcggttgaccgatgcgcaaattgtcaagcgtctgaaacaagtatgcgatgct
gagaaagtggaacataacgaagagggcattgccgccctggtattcagtgctgagggagat
atgcgtcaggctatcaacaacttgcagagtacatggtcgggtttcggtttcgtcagtggg
gacaacgtcttcagggtggtcgacagcccgcacccgatcaaggtccaggcaatgatcaag
gcctgctgggaaggcaaggttgatgcggcgttggagacactgaatgaattgtgggaattg
gggtattcctcccatgatatcatcagtaccatgttccgtgtcaccaagacaattcccact
ctgtcagaacattcgaagttggaattcatccgggagattggttttacgcacatgcgcatt
ctagacggcgtgcagtcactgctgcagcttagcggctgcgttgcgaagctttgcaggatc
aacatgaagccgcagctctttgagccgccgaagaattga

KEGG   Aspergillus niger: ANI_1_598024
Entry
ANI_1_598024      CDS       T01030                                 

Symbol
An02g04290
Name
(RefSeq) replication factor C subunit 1
  KO
K10754  replication factor C subunit 1
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_598024 (An02g04290)
   03420 Nucleotide excision repair
    ANI_1_598024 (An02g04290)
   03430 Mismatch repair
    ANI_1_598024 (An02g04290)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_598024 (An02g04290)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_598024 (An02g04290)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    ANI_1_598024 (An02g04290)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     ANI_1_598024 (An02g04290)
SSDB
Motif
Pfam: RFC1 BRCT AAA AAA_22 AAA_33 Rad17 AAA_16 RuvB_N AAA_30 DNA_pol3_delta AAA_18 Sigma54_activat AAA_5 AAA_28 AAA_14
Other DBs
NCBI-GeneID: 4978916
NCBI-ProteinID: XP_001399565
UniProt: A2QCP5
AA seq 1058 aa
MPADIRSFFGGKSSQGSNPSPAKPAPKKEEPPTRKKRTRKVVDDSDEEEVVATKSVSPKV
KAPSKPQPEVSKGEPTTSSDYFASSKKRGRPAKETKTSQPAVTDEPEAKPSPKPKKSTST
EKPAPRPQRGTRKATTVVDDDELGGDDIHATEYKKTGKGDDDYVEEEDKESDSDFEELAV
KPASAASGRQGRKKAATAESDEDVVMEDLPKRPSRAAKSAATQPARKRKSEVLEKDEDYD
SKTSPKKAAQTKAAPRTPKKPRASTKTDRPESKEIQDIFDSIPTIRPPSPPRETGEKAKF
NYAAHAQRSRSPVAGGADIPEGAENCLAGLSFVFTGVLDTLGRDEGQNLVKKYGGKVTGA
PSSKTSYVVLGADAGPKKLATIKQHNLKTINEEGLFELIRRLPANGGDGKAAEQHEAKKK
AEEEKIRAMAAEIDREEKRKAAATRNTAPSGPQPPSSSQSTTQSTKTDDRLWTTKYAPTS
MNMICGNKGVVEKLQNWLRDWHKNAKAGFNKPGKDGSGMYRSVMIHGPPGIGKTTAAHLV
AKLEGYDVVETNASDTRSKKLVENGLLGVLDTTSLQGYFSGVGKKVESAKKNLVLIMDEV
DGMSAGDRGGVGALASIAKKTHIPLILICNERRLPKMKPFDHVTYELPFRRPTAEQIRAR
LSTICFREGLRIPPQVLDSLIEGTNADIRQVINMLSTVKLDQTNLDFEKGKQMSKAWEKH
IVLKPWDIVGKILSAQMFSPSSKATLNDKIELYFNDHEFSPLMLQENYLKTRPALAGAYH
GREQKLKQLELMDNAASSISDGDLVDRMIHGTQQQWSLMPTHAVFSFVRPASFTYGNMME
RPGFTSWLGQNSKQGKLWRYIKEIQGHMRLRASGDRDEIRQQYMPLLWDRLVRRLMVEGK
DSVDDVIDFMDSYFLTREDWDALVELGLGPMDESNVKLQTQTKAAFTRIYNQRSHPLPFI
KASSIAAPKKMPKEKPDIEDAIEESDEEEVLEDDSKDNDESEELDLKKDKYVRVPKKAAK
GGAAKGRKSKKAAAGDDDFIDDEEEKPKKARGRKPKAK
NT seq 3177 nt   +upstreamnt  +downstreamnt
atgcctgctgatattcggagcttttttggcggcaagtctagtcaaggctccaacccatct
cccgcgaagcccgcgccaaagaaagaggagcctcctacgagaaaaaagcggactagaaag
gttgtagacgacagtgatgaggaagaagttgtcgctaccaagtccgtaagcccgaaggtg
aaggctccgagcaagccacagccagaagtatcgaagggtgaacccacaacttcgtcagac
tatttcgcatctagcaagaagagaggcaggccagccaaggagaccaagacatctcagcct
gctgtcaccgacgaacccgaagcgaagccatctccgaaaccgaaaaagtctacgagcacc
gaaaaacctgcaccaagacctcaacgcggtacacgaaaggctaccacagtcgttgacgac
gatgaactcggtggcgatgatatccatgcgacagagtacaagaaaacaggcaagggggat
gatgattatgtcgaggaagaggataaggagagtgacagtgactttgaggaacttgcggta
aagccggctagtgccgcctctggaagacagggacgtaagaaggcggcaactgctgaatcg
gatgaggatgtggtaatggaggacctgccaaagcgaccttccagggctgccaagtcagcc
gccactcagccagcgcgcaaacgcaaatccgaagttctcgagaaggacgaggactacgac
tccaaaactagtcctaagaaggccgcgcagacgaaagccgctccccgtacccctaagaag
ccaagggcgtctaccaaaaccgatcgacctgaaagcaaggagattcaggatatattcgac
agcatccctacgatcagaccaccctctcctccgcgcgagactggtgaaaaggccaaattt
aactacgctgctcacgcacagcgctcgcggtcaccagtagctggaggggcggacatacca
gagggagcggaaaattgtcttgcagggctctcctttgttttcactggtgtcttggacaca
ctcggccgcgacgaaggacaaaacttggtcaagaagtatggcggtaaagttactggagcc
cctagttccaaaaccagctatgttgttctgggagcggatgccggacctaaaaagctggca
acgattaagcagcacaatctaaagacaattaacgaggaaggacttttcgagcttattcga
cgacttccagccaatggtggagatgggaaggcagcagagcaacatgaggcgaaaaagaaa
gcagaagaagaaaagattcgcgcgatggccgctgagatcgaccgcgaagaaaagcgcaag
gcggcggctacgcgtaacactgctccctcagggcctcaaccgccatcaagttcgcaaagt
acgacgcaaagcacgaagactgacgaccgcctgtggaccaccaaatatgcgccgacatcg
atgaatatgatttgtggtaataaaggtgttgtcgagaaactacagaattggcttcgcgac
tggcataagaatgccaaggctggattcaacaagccagggaaggatgggtcagggatgtat
cgctctgtcatgattcacggaccgcctggaattggcaagaccactgcagcacacctggtg
gcaaagctagaaggatacgatgtcgtggagacgaatgcaagtgacacaagaagcaagaag
ctcgttgagaatggccttctcggtgttttggacacgacttcgctgcaaggctacttttcg
ggtgttgggaagaaggtggagagtgcgaagaagaatttggtcctcattatggatgaagtt
gacggaatgtccgctggtgatagaggtggtgtgggagcactcgcctcaatcgccaagaag
actcacatcccgctgattttgatttgtaacgagcgaaggctcccgaaaatgaagcctttc
gatcatgtcacatatgaacttccgttcaggagaccgacagccgaacagattagagcccga
ctgtcgaccatctgcttccgcgagggcttgaggatcccgcctcaggtcttagacagcctt
attgaaggcaccaacgcggacatccggcaagtgatcaacatgctttcaaccgtcaaatta
gaccagacaaacctagacttcgagaaggggaagcaaatgtccaaagcatgggaaaagcac
atcgttctaaagccgtgggatatcgtcggcaagatcctcagtgcgcaaatgttctcgcca
agctccaaggctactttaaatgataagatcgaactctacttcaatgatcacgaattcagc
cccctgatgcttcaggagaactacctgaaaacacgaccggcgttagcgggcgcatatcat
ggcagagaacaaaagctgaaacagcttgaactaatggacaacgccgcttcgagtatcagt
gatggtgatctcgttgacaggatgattcatggtactcagcagcaatggagtctgatgcct
acccatgcggtgttcagttttgtgagaccggcgagctttacgtacggaaacatgatggag
cggcccgggtttactagttggttgggacagaacagtaaacaaggcaagctttggcgttac
atcaaagaaattcagggccatatgcgtcttcgcgcatctggagatagagatgagattcga
caacagtatatgccgctcctttgggacaggctagtccgccgactaatggttgaaggtaag
gatagcgtcgacgatgttattgatttcatggacagctatttccttacgcgcgaggattgg
gatgccttggtagaacttgggctgggacctatggatgaatccaatgtgaagctgcagaca
cagacgaaagcagcattcacgcggatctacaaccagcgctcccaccctcttccattcatc
aaggccagcagtattgctgctcccaaaaagatgccgaaggagaagcctgacattgaagat
gccattgaggaatcggatgaagaagaggtactcgaagacgactcgaaggacaatgacgag
agcgaagagcttgatttgaagaaggacaagtatgttcgcgtgcccaagaaagctgcgaag
ggtggagcggccaaaggaaggaaatcgaagaaggcagcagcgggcgacgatgatttcatc
gatgacgaggaagagaagcccaagaaggctcgaggccggaagccaaaggccaaatga

KEGG   Aspergillus niger: ANI_1_604024
Entry
ANI_1_604024      CDS       T01030                                 

Symbol
An02g04320
Name
(RefSeq) replication factor C subunit 5
  KO
K10756  replication factor C subunit 3/5
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_604024 (An02g04320)
   03420 Nucleotide excision repair
    ANI_1_604024 (An02g04320)
   03430 Mismatch repair
    ANI_1_604024 (An02g04320)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_604024 (An02g04320)
   03036 Chromosome and associated proteins [BR:ang03036]
    ANI_1_604024 (An02g04320)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_604024 (An02g04320)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    ANI_1_604024 (An02g04320)
  DNA Replication Termination Factors
   ELG1-RFC complex
    ANI_1_604024 (An02g04320)
Chromosome and associated proteins [BR:ang03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    ANI_1_604024 (An02g04320)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     ANI_1_604024 (An02g04320)
  Check point factors
   HRAD17(Rad24)-RFC complex
    ANI_1_604024 (An02g04320)
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA AAA_22 Rep_fac_C AAA_24 AAA_16 DNA_pol3_delta Rad17
Other DBs
NCBI-GeneID: 4978919
NCBI-ProteinID: XP_001399568
UniProt: A2QCP8
AA seq 352 aa
MALLVDKLRPRSLDALTYHPELSARLKSLAQSGDFPHLLMYGPSGAGKKTRTIATLKELY
GSGVEKIKIDARVFQTTSNRKLEFNIVSSVYHLEITPSDVGNYDRVVVQELLKEIAQTQQ
VDLSAKQRFKVVVINEADHLTRDAQAALRRTMEKYSPNLRLILLANSTSNIIAPIRSRTL
LVRVAAPSEEDICTVLKNAAKKEGWPEASGLNKRIAKESGRNLRRALLMFEAIYAQNEKV
TDNTLIPPPDWEALIALIAEEILAERSPARLLQVRARLYDLLTHCIPPTTIIKCLTFNLI
TKVDDALKPDVIRWSAFYEHRITQGSKVIFHLEAFVAKFMRIYESYLMGMEF
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccttgctagtcgacaaactgcgaccgcggtcgctagatgccctcacataccaccct
gagctgtccgcgcgactgaaatcattggcgcaaagcggcgacttccctcatctgctcatg
tatggtccttcaggtgcaggcaaaaagacacgaacaatcgcgacgcttaaagaattgtac
ggttccggagtcgaaaagatcaagatcgacgccagagtcttccaaacgacaagcaaccgc
aagctcgagttcaacatagtgtcttcggtctaccacttggagatcactccatcggatgtt
gggaactacgatcgtgttgtggttcaagagctgctgaaggagattgcacaaacccagcag
gttgatctctcggcgaaacagcgcttcaaagtcgttgtgattaacgaggccgatcatctc
acccgtgatgcacaggcagcgctgagacggacgatggaaaaatatagtcccaacttgagg
ttgattttgttggcgaatagcacttcgaatatcatcgcccctatccggtcccgtaccctg
ctggtcagggttgctgctccgagtgaggaggatatctgcactgttttgaagaacgcggct
aagaaggagggatggcctgaggcgagtgggttgaataagaggatagctaaggagagtggg
cgtaaccttcgtcgcgcgcttctaatgttcgaggctatttatgctcagaatgagaaagtt
acggacaacacgctcatcccaccacccgactgggaagcgctgattgcgttgatagctgag
gagatcctggcagagcggtcaccggctcgtctgttgcaagtccgcgcacggttatacgat
cttttgacgcattgcataccaccgactaccattatcaagtgtctgacattcaacctcatt
acaaaggtcgacgatgctctaaagcccgatgtcatcaggtggtcggcattctatgagcac
aggatcactcaaggcagcaaagtaatctttcaccttgaggcattcgttgccaagttcatg
cgcatatacgaaagttatctgatgggcatggaattctaa

DBGET integrated database retrieval system