KEGG   Aspergillus niger: ANI_1_1776184
Entry
ANI_1_1776184     CDS       T01030                                 

Symbol
An04g03810
Name
(RefSeq) RNA polymerase II transcription factor B subunit 3
  KO
K10842  CDK-activating kinase assembly factor MAT1
Organism
ang  Aspergillus niger
Pathway
ang03022  Basal transcription factors
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    ANI_1_1776184 (An04g03810)
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_1776184 (An04g03810)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ang03021]
    ANI_1_1776184 (An04g03810)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_1776184 (An04g03810)
Transcription machinery [BR:ang03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ANI_1_1776184 (An04g03810)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     ANI_1_1776184 (An04g03810)
SSDB
Motif
Pfam: MAT1 zf-C3HC4_5 zf-C3HC4 zf-C3HC4_2 zf-RING_2 Zn_ribbon_17 zf-RING_4 zf-RING_UBOX
Other DBs
NCBI-GeneID: 4990787
NCBI-ProteinID: XP_001401747
UniProt: A2QIK1
AA seq 384 aa
MPPARDIMAHRGDDDEVCPVCKSSRYLNPDMRFLINPECYHKMCESCVDRIFSSGPANCP
VAGCHKTLRKNRFRKQTFEDINVEREVDIRRRVMQILNRREEEFDSKRAYDDFLEQREEI
IANLVHGTDVAKTESDLQRYAADNMRSIRANQALEAQEASSFREQQTHEQELARLRREAA
RLEYENERKEMLAGREDVLSRLAAGRPGDAAAIAREGHKVLLKKSSARRSEEDRIRQKQA
ALRSSDARKAGQGALTTADRADDSGDSGLIKGLKKIVTPEPEKPYDPFGGLVPNKRDYYT
LRDYYPNSYLDPIRQDTRMQAGGYDLQEYYSRTLMEAFAGLGCFIDEEVSKREVTSTMGI
SRPVATEGAALAAVSSAGAPEASS
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgcctcctgctcgtgatatcatggctcaccggggggatgacgacgaggtgtgccctgtc
tgcaaatcctcccgttacctgaacccagacatgcgatttctcatcaatcccgaatgctac
cacaagatgtgcgagtcctgcgtggaccgaatcttctcctcaggccctgcgaactgtccc
gtggcgggctgtcacaagaccctgcgcaagaaccgatttcgcaagcagacattcgaggat
attaatgtggaaagagaggtggacattcggcgcagagtaatgcaaattcttaaccgccgc
gaagaagagtttgattcgaaacgagcctatgatgacttcctcgaacaacgcgaagagata
atagcgaaccttgtccatggcacagatgtggcgaagacagaaagcgacctacaaagatat
gctgcagacaacatgcggtcgattcgcgccaatcaagccctcgaagcgcaagaggcctca
tccttccgagaacaacaaacacacgaacaagaactggcacgtcttcggcgagaggcagct
agactggaatatgagaacgaacggaaggagatgcttgccggccgggaagacgttctcagc
cgtcttgcggcaggtcgacctggcgacgcagcggctatcgcccgcgaaggtcacaaggtg
ctgcttaagaaatcttctgctcgccgcagtgaagaagaccggattcgacagaagcaggct
gctttgcgcagctcagatgccaggaaagctgggcagggcgcccttaccacggcggacagg
gcggatgacagtggtgattctggcttgatcaagggtcttaagaagattgtgacgcccgag
cctgagaagccttatgatccttttggtggccttgttcccaacaagagggactactatact
ctgcgcgactattacccgaacagctatctcgaccccattcgccaggacactcgtatgcag
gctggtggatacgaccttcaggaatactactcgcgtactttgatggaggcctttgcgggt
ttgggttgcttcatcgatgaggaggtgtctaagcgagaggttacaagtacgatgggtatc
tctagacccgtcgctacagaaggggctgccttggcggctgtttcaagtgcaggcgcccca
gaagccagctcgtga

DBGET integrated database retrieval system