KEGG   Aspergillus niger: ANI_1_1872184
Entry
ANI_1_1872184     CDS       T01030                                 

Symbol
An04g04810
Name
(RefSeq) RNA polymerase II transcription factor
  KO
K03141  transcription initiation factor TFIIH subunit 1
Organism
ang  Aspergillus niger
Pathway
ang03022  Basal transcription factors
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    ANI_1_1872184 (An04g04810)
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_1872184 (An04g04810)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ang03021]
    ANI_1_1872184 (An04g04810)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_1872184 (An04g04810)
Transcription machinery [BR:ang03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ANI_1_1872184 (An04g04810)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     ANI_1_1872184 (An04g04810)
SSDB
Motif
Pfam: BSD PH_TFIIH Rx_N PIN_8 DUF5357
Other DBs
NCBI-GeneID: 4990888
NCBI-ProteinID: XP_001401845
UniProt: A2QIU9
AA seq 627 aa
MAPPSGSAAYKKKDGTLTIAQDRQSISWIPAAGGAAGAITLPVAQITNLQQTPASNPKVM
LKIFVLPPNAPASSPEQYVFSFTAGANARPEADAIRDALSAAIQAAKTAQNAPVKEGVSP
AMAIANAVSSAGKEKNPWDDDKRLQGDVELQQSLLKSNPILQRMFMESLHTKPDTLSASQ
FMTQFWSTRLHLLRAHAIERSQTRGSYNVLSTLKPRVEDSVTKLNISKEQIQLIFNQHPL
VKRVYDENVPKLSEQQFWSRFFQSRLFKKLRGERISETDPTDIILDKYLKADESGNLPRD
AHVPHFLDLAGNEVNNSQRQGNRPDLDMRPSSVEKVPIIRTLNSLSEKIMANVAPADGEA
DGKTGEDGTYNELQLRDLRGDEEQQRILLNVKDQSRFFSSHSKTAEDEQNKLFAQQDPNQ
ILGQLRGDLEQNLPEGGAAPLGRLVEPQEEDDEDQQKFEDVIGSRANLKRASNQILEAIR
DRRSQTEGSGNAGTYGLSTALYDRLTLTHATTTEFLHQFWQAFLSGNADRAGEVASLVES
LNRAMERIKSVAQDAETERQVEVDRLKQHAREVLERTGRKLKLNLAGVAGGEQAVNRLLG
PTIRALETALAKYNQALAEEMKEMPSA
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggcacctccgagcgggtcggcggcatacaagaagaaagatggcaccctgaccatagcc
caggaccgccagtcgatctcttggatcccggcggctggcggtgcagctggtgcaattacc
cttccagttgctcagattaccaatttgcaacagacccccgcgagtaacccgaaagtgatg
ctgaagatctttgtcctccctccgaacgcccctgccagttcccccgaacaatatgtcttc
tcctttacagctggagcgaacgcgcgaccggaagctgatgccatcagagatgcgctcagt
gccgctattcaagctgcaaagacagctcagaatgcccccgttaaagaaggcgtgtctcct
gctatggccatagcgaatgctgtatcatcggcagggaaagagaagaacccatgggatgat
gacaagcggcttcaaggagatgtggagttgcaacagtcgctgctgaagtcgaatccgatt
ctccagcgcatgttcatggagtcgttacataccaagccggatactttgtctgcttcgcag
ttcatgacgcagttttggtccactcgacttcatcttttgcgcgcgcatgcgatcgagcgg
tcgcagacacgcggatcctacaatgtgctatcgacattgaagccgcgggtggaggatagc
gtgacaaaattgaatattagcaaggagcagatccagttgattttcaatcagcacccgctt
gtgaagcgggtgtacgatgagaatgtacccaagcttagcgagcagcagttctggtctcgg
tttttccaaagtcggttgttcaagaaactgcgcggagagcgcatctccgaaacggatccc
acggacataatcctggacaaataccttaaggcggacgagtcgggaaatttaccgcgcgac
gcgcatgttccgcatttcctggatctggctggaaatgaagtgaacaacagtcaacggcaa
ggtaaccgacctgatctcgacatgcgcccgtcctcggtggagaaggtgcctatcatccgc
accctgaatagtctgagtgagaagattatggcgaacgttgcaccagccgatggcgaggca
gatggcaagacgggtgaggatgggacgtacaacgagctgcagctgcgtgacttacgcggg
gacgaggaacagcaacgtatcctcctcaacgtcaaggaccaaagtcgctttttctcgtca
cactcaaaaactgcggaggacgagcaaaataagctgtttgcccagcaggatccaaatcag
atactcggacagctacggggggatctggaacaaaatctgcccgagggcggagccgcgccg
ctggggagattggtagaaccgcaggaagaggacgatgaggatcagcaaaagttcgaagac
gtaattggctctagggccaatttgaagcgcgcctcaaaccagatcctcgaagcgatccgt
gaccgccgctcccaaacagagggatcaggcaatgccggcacatatggtttgtcgactgca
ttgtacgaccggctgaccttaacgcatgccacgacgactgaatttctgcatcaattctgg
caggcatttctgtcaggaaacgcggatcgcgcaggtgaggtagcttcgcttgtggagtca
ctgaaccgagccatggagcgcattaagtcggtggcgcaagacgcagagacagagcggcag
gttgaggttgatcgactgaagcagcatgcccgagaagtgctggaaaggacgggaaggaag
ctgaagctcaatctcgccggtgtggctgggggcgaacaagctgtcaatcgactattgggg
ccgaccattcgggcgttggaaacggcattggcgaagtacaaccaggcgttggctgaagaa
atgaaggaaatgccatctgcgtga

DBGET integrated database retrieval system