KEGG   Aspergillus niger: ANI_1_2054024
Entry
ANI_1_2054024     CDS       T01030                                 

Symbol
An02g14830
Name
(RefSeq) DNA polymerase epsilon subunit B
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03410  Base excision repair
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_2054024 (An02g14830)
   03410 Base excision repair
    ANI_1_2054024 (An02g14830)
   03420 Nucleotide excision repair
    ANI_1_2054024 (An02g14830)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_2054024 (An02g14830)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_2054024 (An02g14830)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ANI_1_2054024 (An02g14830)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    ANI_1_2054024 (An02g14830)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      ANI_1_2054024 (An02g14830)
SSDB
Motif
Pfam: DNA_pol_E_B
Other DBs
NCBI-GeneID: 4980022
NCBI-ProteinID: XP_001400612
UniProt: A2QFK1
AA seq 748 aa
MDSDPVPSSSPGFGTPAYPFRKNRPNALPTRTSVLPILLPPSTLRPVAFRTFTRKHNLTI
SSSALQTLATFVGKNCGSAWREEGLAERALDEVAKAWKKAGGGVIVDEGKGASLKAILQT
LESNMSGGRVISGKHATPDEVPSRTTSPGQGNRRSRADPQLYAAAGLEGEGAAENSDVPS
HPRHWVRVIEAFDIPRLTYNADKRYFEVARSRPTLFPPSSHRTNLFRDRYNVIHQRLLRH
ESFQSPSGPSRILRKSSSSLAVTQGYKLTPIANLLGRNGTSHLILGLLSMSPTGDLNLSD
LTGSISLDLRHARMVPEDGAWLAPGMFVLVDGIYEEEENVRGSTLGGNSGVGGAIGGVFV
GVSICGPPCERRETSLGMNNQQSGREVSSSGGLGWIDFLGVGSERAQGPRMRHIEASYLR
GVHGSAEGDRRLKVAALGEVNLDDMRTLDALRKVFSVYHHLPLEERPSIFVLTGNFVQKA
IINSSGQAGSIEYKEHFDALSLILSEFPSLLQHSTFVFVPGDNDPWPSAFSAGAASPIPR
HSIPELFTTRVKRAFATANSQLDSSQPSGPPGEAIWTSNPSRLTLFGPVHDIAIFRDDIS
NRLRRNAVNLSHGADTAMAEDAHASAGETDHLEPHSHSPQTGISSSLVPSTTLFARRLVK
SILDQGTLSPFPLSLRPVLWDYVSSLQLYPLPTAIILADPEAAPFCITYEGCHVMNTGRL
VPEGELSFVRWVEYDAIKNRGRIQQERL
NT seq 2247 nt   +upstreamnt  +downstreamnt
atggactcggaccccgtaccctcatcatcacccggatttggaacacccgcctatcctttc
cgaaaaaatagacccaatgcgctgccaacgaggacatcggtccttcccatactgcttcct
ccttcgacacttcggcctgtggccttccgtaccttcacgcgcaagcataatctaacaata
tcctcctctgcgcttcaaacactagccacctttgtggggaagaattgtggctcagcatgg
cgcgaagaaggtctcgcagaaagagcactcgatgaagtggctaaagcctggaagaaagct
ggcggtggcgtcattgtcgatgaagggaaaggcgcctcactgaaagccatcctccagact
ttagagagcaatatgagtgggggaagggttatctctgggaagcacgccacgccagatgag
gtcccttcgagaacaacaagcccaggccaaggaaacagacgctctagggccgatccgcaa
ttgtatgcagcggcagggctggaaggagaaggtgcagcagaaaattctgacgtaccctca
cacccgagacattgggttagggttatcgaggcttttgatataccgcgattgacctataat
gcggataagagatacttcgaagtcgcaagatcaaggcccactctgttccctccatcctct
cacaggaccaatctgtttagggatcgttacaatgttatccatcaacgtctgcttcggcat
gagtcattccaatcaccgtccggtccctcgcgtatcttgcggaaatcatcatcttcttta
gcggttacccaaggctacaagctcacaccaatcgcgaatttactcggaagaaatggcaca
tcacaccttattctaggtttactctcaatgtccccaacgggggacttgaatttgagcgat
ttaaccgggagtatttctttggatctgagacacgcgcggatggtgcctgaagacggagcc
tggctcgctccagggatgtttgtcctcgttgatgggatatatgaggaagaggaaaatgtt
agggggtctactctaggcggcaattccggggtcgggggtgccattggaggagtttttgtg
ggcgtttctatatgcggtcctccttgtgagcgacgggagacatctctcgggatgaacaac
caacaaagtggcagagaggtcagttccagtggggggcttggatggattgacttcctggga
gttggaagtgaacgtgcgcagggcccgcgaatgaggcatattgaagccagctatctacga
ggtgtacacggaagcgctgaaggcgaccgccggttaaaggtggctgctttgggggaggtt
aatctggatgatatgaggactttagatgcgttgaggaaggtcttcagcgtctatcaccac
ttgcctttggaggagcgtccaagcatatttgtcctgacggggaacttcgtgcaaaaagcc
atcataaacagcagtggccaggcgggcagcatcgagtacaaagaacatttcgatgctctc
tccttgatactgtcggagttcccttcgttgttgcagcactcgacattcgtatttgttccg
ggcgacaatgatccatggccgtcggctttctcagctggcgccgcctccccaatcccacgc
cattcgattccagaattattcactactagagtgaaacgagcatttgctactgccaactcg
cagttggactcctctcagccgtctgggcctcctggggaagcgatatggacttcaaatcct
tcccgccttaccctattcgggcctgtccatgatattgcgatattcagagacgatatttct
aacagattgagacgaaacgctgtaaacctctcacatggcgccgacaccgcgatggctgaa
gacgcgcacgcttctgccggggaaaccgaccatctcgaacctcacagccatagcccacag
acaggcataagctctagtctagtcccgagtacaacccttttcgctcgaaggcttgtgaaa
tcgattctcgaccagggcactttgtcgcctttcccgctttctttgcgacccgttttgtgg
gattatgtctcctccttacagctgtatccgttgccaactgcaatcattctagcagatcca
gaggccgcgccgttttgtataacgtatgagggctgccatgtgatgaatactggcaggctt
gttccggaaggcgagctatcctttgtccggtgggttgagtatgatgccatcaagaatcga
ggcaggatacagcaggaacgcttgtag

KEGG   Aspergillus niger: ANI_1_434144
Entry
ANI_1_434144      CDS       T01030                                 

Symbol
An16g03060
Name
(RefSeq) DNA polymerase epsilon catalytic subunit A
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03410  Base excision repair
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_434144 (An16g03060)
   03410 Base excision repair
    ANI_1_434144 (An16g03060)
   03420 Nucleotide excision repair
    ANI_1_434144 (An16g03060)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_434144 (An16g03060)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_434144 (An16g03060)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ANI_1_434144 (An16g03060)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    ANI_1_434144 (An16g03060)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      ANI_1_434144 (An16g03060)
SSDB
Motif
Pfam: DUF1744 DNA_pol_B_exo1 DNA_pol_B DNA_pol_B_exo2 RNase_H_2 AMP-binding_C_2
Other DBs
NCBI-GeneID: 4988699
NCBI-ProteinID: XP_001397618
AA seq 2233 aa
MPSRKPSKFGNKFRSSAASFNPKRTKTIEFSSLRSTEATSQDEKFEAIRLANSIDESLGF
PRYESGEKRVGWLINMHSTSIEDPNVPGGRAGVDYYFLEDGGGSFKATVEYDPYFLIAVK
KGRETEVEDWCRRTFEGLIKKVLRVEKEDLKLPNHLLGYKRTFLQLNFASVSHLLEVRKT
LLPLAEKNKKNVNVMDTYMEISSANAGFDLFDDELINESRSNATMNASDFIIDIREYDVP
YHVRVSIDKDIRIGKWYTVEAKHGVISLTCIEERLTRADPVVLAFDIETTKLPLKFPDSV
IDQIMMISYMIDGQGFLITNREIVSEDINDFEYTPKPEYSGPFMIFNEPDERGVLERFFE
HIKEAKPTVIATYNGDFFDWPFVEARASVLGIDMYREIGFRKNSEDIYQSDHCVHMDCFA
WVNRDSYLPQGSRGLKAVTVAKLGYDPDELDPELMTPYASERPQTLAEYSVSDAVATYYL
YMKYVHPFIFSLCTILPINPDDTLRKGTGTLCEMLLMVQAYQGNIVLPNKHKDPPESFYE
GHLLESETYVGGHVESIEAGVFRSDIPVTFNVQPAAIDELLRDLDAALKFSIEVEEKKSM
DDVTNYEEVKKQIADKLIDLKERPHRDEVPFIYHLDVASMYPNIMITNRLQPDSMIQESN
CAACDFNRPGKTCDRRLPWAWRGEFLPAKRDEYNMIRQAVANERFPGKHKNSPMRSFGDM
SIEEQAGIIKKRLQDYSKKIYHKIHDSKTMVREAIICQRENPFYVDTVRSFRDRRYDFKG
KQKVWKGKTDALKSSGASAAEVEEAKKMIVLYDSLQLAHKVILNSFYGYVMRKGSRWYSM
EMAGVTCLTGARIIQMARELVERIGRPLELDTDGIWCMLPGSFPENFSFTLKNGKKLGIS
YPCVMLNHLVHGSYTNHQYQTLVDQATFRYEQNSENSIFFEVDGPYKAMILPTSKEEDKN
LKKRYAVFNHDGSLAELKGFEVKRRGELKLIKIFQTQIFRFFLEGTTLTETYAAVAKVAD
RWLDVLYEHGATLADEELIDLISENRSMTKTLEEYGNQKSTSITTARRLAEFLGEQMVKD
KGLNCKYIISSKPRNTPVTERAIPVAIFSAEENVKRFFLRKWLKDDPGDMDPRTVIDWDY
YLERLGSVVQKLITIPAALQKIRNPVPRVAHPDWLQRRINTKDDRFKQTKMTDMFIKSDK
PEKNPLTDISTNILDHRVQHTGDLDEAIANSTQKLKPSSETKVSQKRKHPEGLSKTSLDP
FATLPAQMPSMADDYVGFLKYQKQKWKIQKQARIRRRQLFGERANAGGDSLSNLFRNQAE
LLYINTWQILQLSETGRPGIVRAFVLIDRKIHALTVKVPRQIYVNLKQDSLPDVDVPDCE
VEKVTHTLPNGHPSVHLFKLTLSEETYLREAEKIDVLFQHPSVEGVYEKNIPLNIRAVLK
LGSICTFDEEQRGVLGEGLDRGFDLSTLCRTTTEQPYLLDSPLAFHYLYHVASGDRQIFA
LFSSTKNEAHVVILNRTRDVQGLPNLDKIYSELLARRMQTMEGDQSQAAFEYQEKIHFRT
TQVTTRRKAHLEVGDLIKKFKSEETMPAVMVIQSQQRKRLCHDIPILREYPTLPVKPEVS
DMDLPPLGWQSFIARRLVTHYLYLSAWVQHLTLLARYGDVPLCNLENDDPRFLIDISYAR
RLQQNNVVLWWSSNPRPDHAGYEKDDISGPLEKVSMPSVNVPSAYTTVCIELEVRNLAIN
TILTSSIINEMEGADTLLASSGQSADPNGGGVLYSEKAFASAGAVVLREMVKHWWTEACD
GNSMADIMVQHLIRWVESPVSCLYDRSLHHYVRMLSRKSFQRLMAEFRRVGSNVIFASST
RLLLQTSKTEVGNAYAYSQYVLKSIRANPSFHFIDLEIKEYWDYLLWYDEYNYGGKGCQE
VVESDEQELETVMHWQLNRTLPTPMQTIFHDWVVEYIELMHGLKRPDTNDSTPRLTQIPI
GRPSDEDSQEVSAALAEKFSKPLKKQITGLIRRQRDELLHPELASDYIFPVLPGVLSDPN
EEKRNPVLELVKLLMQVLSLSKITTMETRLLRRELLALFEVREFSKEGRFENPGASLKIP
ELTCGSCCLIRDLDLCRDEDVLPEPGVDASKTSTKPWRCPFCQTEYDRLAQEEILIGQIQ
GYIVGWQTQDLKCSKCGTLKVSDFMEHCSCSGVWVETMDRKEIERKLHILNSVAKFHGLK
LLESVVGEVLAQM
NT seq 6702 nt   +upstreamnt  +downstreamnt
atgccttcaagaaaacccagcaagtttgggaacaaattccggtcgagcgcggcctccttt
aatcccaaaagaacgaagacaatcgagttttcgtcgctccgatccaccgaggcaacctct
caagatgagaaattcgaggcgatccggctggccaacagcatcgatgaatccttgggtttc
ccccgttatgagtccggcgaaaagcgagttggatggctcatcaacatgcacagcacctcc
atagaagatccaaacgtccccggaggacgcgccggcgtggattattactttctcgaagac
ggaggtggaagtttcaaggcgactgtcgaatacgacccatatttcttaattgctgtgaag
aagggccgtgaaactgaggttgaggattggtgtcggagaacgttcgaagggctcatcaag
aaggtattgcgggtggagaaagaggacctcaagctgccaaaccatctgcttgggtacaaa
cggacctttctccagctcaactttgcgagtgtgagccatttattggaggttcgcaaaaca
ctacttcctctggcggagaagaacaagaaaaacgtaaatgtgatggatacttatatggag
atctctagcgcaaatgctgggtttgatctctttgatgatgaacttattaatgaatcacga
tctaatgctactatgaatgcgagcgatttcattattgatattcgagaatatgatgttccg
tatcatgttcgagtctccattgacaaagacattcgaataggaaaatggtatacagtagag
gcaaagcatggcgtcatctcattgacatgtatagaagaacgactcacgcgagccgaccct
gtcgttctagcattcgatatcgagacaaccaagctaccgctaaaatttcccgactccgtg
attgaccaaatcatgatgatatcctacatgatcgacgggcaaggattcctgattaccaac
cgtgagatcgtatccgaagacatcaatgacttcgaatacacgcccaagccagagtacagt
ggacctttcatgatcttcaacgaacccgacgaacgcggcgttctagagcgattcttcgaa
catatcaaggaagcgaagcctactgttattgctacctataacggtgattttttcgattgg
cctttcgtggaagctagggctagcgttctcggcatcgacatgtacagggagatcggtttc
cgcaagaacagcgaggacatctaccaaagtgaccactgcgttcacatggattgcttcgcc
tgggtgaatcgtgatagttatttgccccagggaagtcgtggtctaaaagctgttacagtc
gcaaagcttggatatgatcccgatgaactcgaccccgagctaatgactccatacgcaagc
gaacgccctcagaccctggcagaatattccgtttccgatgccgtcgcaacatactacctc
tacatgaaatatgtccatcctttcatcttctcgctgtgtacaattcttcctattaacccc
gacgacacgctgagaaagggcactggaactctatgtgagatgctgctcatggtgcaggcg
tatcaaggaaacatcgtcctgccgaacaagcacaaagaccccccggaatccttctatgaa
ggacatctactcgaatcagaaacttatgtcggaggacacgtcgagagtatcgaagccggc
gtgtttcgaagtgacatccctgttacgttcaacgtgcaacctgctgcgatagacgagctc
ctccgggatctggatgcggccttgaagttcagtatcgaagtagaagagaagaaatcaatg
gacgatgttacaaactacgaggaagtcaagaagcagattgcagacaagttgattgacctc
aaagagaggccacacagggatgaagtgccgttcatctatcacttggacgttgcatctatg
tatccgaacatcatgatcaccaatcgactgcaacctgactccatgattcaagagtcgaac
tgtgccgcttgtgacttcaatcgacctggaaagacatgcgataggcgactaccatgggcc
tggagaggtgaattccttccggctaagcgcgacgaatacaatatgattcgccaagcggtt
gccaacgaacggttccctggaaagcacaagaatagcccgatgaggtccttcggtgatatg
agcatcgaagaacaggccggcatcatcaaaaagcgacttcaggactacagcaaaaagatt
taccacaagattcatgacagtaaaacaatggtcagggaggccatcatttgtcagcgagag
aacccattttatgtcgacactgtccgcagtttccgtgaccgaagatacgatttcaagggc
aagcagaaggtctggaaaggcaagaccgatgctctcaaatcttcaggcgcatcagctgcg
gaggtggaagaggccaaaaagatgatcgtcctctatgattccttacagcttgcccacaaa
gtcattcttaacagtttctatggttatgtcatgagaaagggatctcgatggtattctatg
gaaatggctggtgttacgtgcctgacaggtgctcgcatcattcagatggcaagagaacta
gttgaacgcattgggcgacctctggaactcgacactgacggtatctggtgtatgttgcca
ggctccttcccggagaacttttctttcaccttgaaaaacggcaagaagctgggtatctca
tatccttgtgtcatgctgaaccacctcgtccacggaagctacacaaatcatcagtaccag
actctggtcgaccaagccacgttcagatacgagcaaaacagtgagaactctatcttcttc
gaagttgatggtccatacaaagctatgatcttgccaacctctaaggaggaggataagaac
ttgaagaaacgttatgcagttttcaaccatgacggctcgctggcggaactgaagggtttc
gaggtcaaacgtcgtggagagctgaaactgatcaagattttccaaacacaaatcttccgt
ttcttcctggaaggcactactcttactgagacgtatgctgcagtggccaaggtagctgac
cgatggttggatgtactttacgaacacggtgcaactttggccgacgaggaacttatcgat
ctcatttcggagaacaggagcatgacaaagacacttgaagaatatggaaatcagaagtca
acgtctatcacaactgcacggcgtctggcagagttcttgggtgagcagatggtgaaggac
aagggcttgaactgcaaatacatcatttcatccaaaccacgaaatacgcctgtcactgaa
cgagccattccggtggcgatcttctctgctgaggaaaacgtgaagcgttttttcttgcgc
aagtggcttaaagatgaccctggcgatatggatcctcgtactgtgatcgactgggactac
tatcttgagcgcctgggctccgttgtgcagaagctcattactatccccgctgcgttacag
aagatccgtaacccggttcctcgcgtcgctcaccccgactggctgcaacggcggatcaat
accaaggatgataggtttaagcaaacgaagatgacagacatgttcatcaagtccgataag
ccggagaagaatccattgacagacatctcgacgaatattctcgaccatcgcgtccagcat
acaggtgatctggatgaagccattgccaactctacacagaagctcaagccatcatccgag
actaaggtctcccaaaagcgaaaacatccggaaggtctatcgaaaacctctcttgatcct
ttcgccacccttcccgcgcagatgccgtcgatggcggatgactatgttggcttcctgaag
taccagaagcagaagtggaagatacagaaacaagcccgaatccgtcgccgccaacttttc
ggtgaaagagcgaacgcaggtggcgactccttgagcaatcttttcagaaaccaggccgaa
ttgctgtacatcaacacctggcagattttgcagctttccgagacaggaaggcctggcatt
gtgcgagcatttgttctcatcgaccgaaagattcatgctctcactgtcaaagtgcctcgg
caaatttatgttaatcttaaacaggattcccttcctgatgttgacgtgccggactgcgag
gttgaaaaggtcactcacacgttgcccaacgggcatccttcggtccatctattcaagtta
acattgtcggaagagacttatcttcgcgaagcggagaagatcgatgttctttttcagcac
cctagcgttgagggtgtttacgagaagaacatccctctcaacatccgagcagttctgaag
ctgggtagcatttgtacgtttgatgaggaacagcgaggtgttctcggagaaggcttggac
cgcggctttgacctttcgaccctatgccgcacgaccacagagcaaccgtatctccttgac
tcgccactcgccttccattatctctatcatgtcgcatctggggacaggcagatttttgcc
cttttctccagcacaaagaacgaggcacatgttgtgatcctgaaccgcacgcgggatgtt
cagggtcttccgaatctcgacaagatctactctgaactcctcgcgcgtagaatgcaaacc
atggaaggagaccagtcacaggctgctttcgaatatcaggagaagatccatttcaggacc
acgcaagtgactactaggagaaaggcccacctggaggttggagacctgattaagaagttc
aagtccgaagagaccatgcctgccgttatggtcatccagtcacaacaaaggaagcgcctg
tgccatgacattccaatccttcgagagtaccctacactgccggtcaaacctgaagtgtca
gatatggatctcccacctctgggatggcagtctttcattgccaggcgcctggtcactcac
tatctctatctctctgcttgggtgcagcacctcacattgctcgctagatacggtgacgtt
cctctttgcaacttggagaacgatgaccctcgcttcctcattgatatctcgtatgcaaga
cggctccaacagaacaacgttgtgctctggtggtcttcaaacccacggcctgatcatgcg
gggtatgaaaaggacgatatctctggtcctcttgagaaggtctctatgccatcagtgaat
gttccaagcgcgtataccacggtatgcattgagttggaagttcgcaacctggcaatcaac
acaatcctgacatcgtccatcatcaatgagatggagggtgcagatacgcttctggcttcg
tccggtcagtctgcagaccctaacggaggcggtgtcttgtattccgagaaggcatttgcc
tcagccggcgcggttgtgttgcgtgaaatggttaaacactggtggaccgaggcttgtgac
ggaaacagcatggccgatatcatggtacagcacttgattcgatgggtagagagcccagtt
tcatgtctctatgatcggtctttgcatcactacgtgcgtatgctgtcacgaaaatcgttc
caacgcctgatggctgaattcaggcgcgttgggtcaaatgtcatttttgcaagctccact
cgtctcttgctccagacctcaaagacggaggtgggcaatgcctatgcatacagtcagtac
gtgctcaagtccatccgagccaatccgtcgttccatttcatcgatctcgaaatcaaggag
tattgggactatctgctttggtacgacgagtacaactacggtggcaaaggttgccaagaa
gtcgtcgagtctgatgagcaggagttggaaacagtcatgcactggcagctcaatcgtaca
ttgcccacacccatgcagactattttccatgactgggttgtggagtatatcgaactcatg
cacggcctcaaacggccggatacaaacgactctacgccacgattgacgcaaatcccaatt
ggacgtcctagtgacgaggatagccaggaagtttcggctgcccttgcagaaaaattttca
aagccattaaagaagcaaatcactggcctcattcgccggcagcgcgacgagctccttcac
ccggagttagcctctgattacatctttcctgtcctccctggggtattgtcggaccctaat
gaagagaagcgcaatcctgtgttagaacttgtgaaactactcatgcaagtccttagcctg
tcgaagatcaccaccatggagacgcggttactgcgtcgtgagctgctagctcttttcgag
gtacgagaattcagcaaggaaggccgcttcgagaatcccggcgcaagtctcaagattcca
gaacttacctgcggctcttgctgcctgatccgagatctagatttgtgtcgggatgaagat
gtactccccgagcccggagttgacgccagcaagacctcgaccaagccatggcgctgtccg
ttctgccaaactgaatacgaccggttggcacaggaagagatcttgattggtcaaatccag
gggtacattgtcgggtggcagacacaggacctgaagtgctcgaaatgtggaacgctcaag
gtcagtgatttcatggagcactgctcttgcagtggagtgtgggtggaaacgatggatcgg
aaggagattgagaggaagctgcacatcttgaacagcgtggccaagttccacggactcaag
ttgttggagagcgttgtgggagaagttcttgcacagatgtga

DBGET integrated database retrieval system