KEGG   Aspergillus niger: ANI_1_2062064
Entry
ANI_1_2062064     CDS       T01030                                 

Symbol
An07g08490
Name
(RefSeq) ATP-dependent DNA helicase
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
ang  Aspergillus niger
Pathway
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_2062064 (An07g08490)
   03430 Mismatch repair
    ANI_1_2062064 (An07g08490)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_2062064 (An07g08490)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ANI_1_2062064 (An07g08490)
DNA repair and recombination proteins [BR:ang03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     ANI_1_2062064 (An07g08490)
   MMR (mismatch excision repair)
    Other MMR factors
     ANI_1_2062064 (An07g08490)
SSDB
Motif
Pfam: UvrD_C UvrD-helicase AAA_19 UvrD_C_2 AAA_30 AAA_12 AAA_22 AAA_11 DUF294_C
Other DBs
NCBI-GeneID: 4982118
NCBI-ProteinID: XP_001391924
UniProt: A2QP78
AA seq 1003 aa
MAPILDGLNSAQTAAVASPAPILQVLAPPGSGKTKTLTARVAYLLAHHGYRPQDVICCTF
TIKASREMRERLAKLIGDELQKKLILGTFHSICRRYLVTYGYLIGLKKGFGIADSGDSLA
IIKRIVKRLQVGIQPNAARARISHQKAHGVSPDELAAKLNKNSKVLEQREFVQVYREYEA
NLAASNLLDYDDLLVRCVELLRKHPQCVSNVQAVLVDEFQDTNHIQYELMNLFASQNQRI
TVVGDPDQSIYGFRSAEIKNLGRMQQLYKDTSIVLLEDNYRSSGCILSSAQDVIEQDSSR
PAKKLQPTHSLGTMPVLRKLPNSESEALWIVLEIKRCIALTGKLVNYSDFAILLRSAALS
RQIEAQMGKHGIPYRMVGGLRFFDRVEIKLLLDYLRVISQPGNTDALLRIINVPSRKLGD
ESVNLLTKGAEKAKKPLWDFIKDVAQGRSSTEKSLSKPADNGLCTLVGLIESARQKLCEC
TDGSSPRKLLDFLIKKLSFREYLKALHGSNEENRWANVEELLTQADDTPGPENEAENDEN
LPEIQGLEQQQAHPGEEALSRFLANVALSTEVLPQEGEEGEQSDEKVTISTIHAAKGLEW
PVVFVPAVLNGIIPHSRAEDSDEERRLLYVAMTRAQALLYLSYPLRQSRDGEEATLSSFL
PSKLVEERFRFLGPKINDKIIQEIADILRRPMPGSAAISEGRSTCDIPYDDQWTEDGFEA
PDAIIRWDGTRAMGGEPNPKRQRLNQEQSGASTTTYMSWTPPTMNGSNFSVPTTLSLGFS
TAREYIATSDSAAEQPPTTKAETKSNAVAASIIGRKVDGLSQKTISGFFGQPSSSGPKSG
SGAAGRYQPQGNRRDAVGQTRHSGSSNSEFKSVIPSNLRTYRPQGPKLQSPRPVLEPSDP
NQYTWLAASSKPSEGQKLFSRATQGPKLTDEGTSEAGKDLRTSEIKSLSGTVGGARPVAT
YHTTTMSMVQTGPATTMRRTLGIRRSMNGWADRMKRENNGPSS
NT seq 3012 nt   +upstreamnt  +downstreamnt
atggctcctatcctagatgggctcaattccgcacagacagccgccgtagcgtctccggcc
cccatcctccaggtcctcgctccacccggctcaggaaagaccaagaccctgaccgcacgc
gtcgcgtacctgctcgcgcaccatggctaccgaccacaagatgtcatctgctgcacattt
acaatcaaagctagtcgggagatgagggaacggctggcaaagctgatcggcgatgagtta
cagaagaagctgattctgggaacgttccattcgatatgtcggagatacctggtaacgtat
gggtatttgatcgggttgaagaaagggtttggtattgcggattcgggggatagtttggcg
attatcaaaaggatcgtcaagcgattacaggttggaatccagcctaatgcagcgagggca
aggatatcacaccagaaagctcatggagttagcccggatgagctggcagcgaaattgaac
aaaaattcaaaggttctggagcagagagagtttgttcaggtatatcgtgagtatgaggca
aatttggcagcatcaaatttgctggactacgatgatctacttgtacgctgcgtggaactg
ctcaggaagcatccgcagtgtgtatcgaacgttcaagctgttctggttgatgagttccaa
gatacgaaccatatccagtatgagttgatgaatttgtttgcgtcccagaatcagcggatc
actgtcgttggggatccggatcagagtatctacggtttccgatctgcggagatcaagaat
ctggggcgtatgcagcaactatataaggatacgtcgattgtcttgctggaggacaattac
cgttcgtcagggtgtattctgagctcggctcaagatgtcatcgaacaagattcatcacgg
ccggcaaagaagctgcagccgacgcacagcttgggcactatgcctgtcctgcgcaagctg
cctaactcggagtcggaggccctctggattgttctggagatcaagaggtgcattgcattg
actgggaagcttgtgaactattcagactttgcgatactgcttaggtcggccgctctctct
cgtcaaatcgaagcccagatgggaaaacatggaattccgtaccggatggttggtgggctg
aggttcttcgaccgagtggaaatcaagttgctcctggactatcttcgagtgattagccag
ccgggtaacaccgatgctctcttgcgcatcataaatgtgccgtctagaaagctcggtgat
gaatcggtcaatctgttgacaaagggtgcggagaaggcgaagaagccgctctgggacttc
atcaaggatgtcgcgcaaggccgcagttcaacagagaagtctctatcaaagcctgccgat
aatggactgtgtaccttggttggtctcatcgaatctgctcgacaaaaactctgtgaatgc
accgacgggtcgtcaccgaggaagctcctcgacttcttgatcaagaaactttcgttccgt
gaatacctcaaggcgttacatggctcgaatgaggagaatcggtgggccaacgtggaggag
ctcttaacccaagctgatgacacccctggaccagagaatgaggctgaaaatgatgaaaat
ctcccggaaattcagggtctcgaacaacaacaagcccatccaggtgaagaggcactgtct
cgctttctggcgaacgtggcactgtccacagaggttcttccccaggaaggtgaagagggc
gagcaatccgatgagaaggttactatttccacgattcatgcagcaaaaggccttgaatgg
cctgtggtatttgttccggccgtgctcaacggcatcatcccacattcacgggccgaggac
tcagacgaggagagaagactgctttatgtagccatgaccagggcgcaggcattgctatat
ctgagctatcctcttcgacagtcccgcgatggtgaagaggcaaccttgtcgagtttcctc
ccgtcaaagctagtagaggagcgatttcgttttctgggacccaaaatcaacgacaagatc
atacaagaaatcgcagatatcctacgtcgaccaatgccgggctcagctgctatatcggaa
ggacgatctacctgtgatatcccatatgatgatcagtggacagaagatggcttcgaggca
cctgatgcgatcattcgctgggacggcaccagagccatgggcggggagcccaatcctaag
agacaacggctcaaccaagagcaatcgggcgcatcgacgacaacgtacatgtcatggacg
ccgccgaccatgaatggctccaacttttctgtgcccaccacgttatccctaggattctcg
acagcccgcgaatacatagcgactagcgactcggccgcagaacaacccccaaccacgaaa
gccgagaccaaatcgaacgccgtagctgccagcatcatcggtcgcaaagtggatgggcta
tcgcagaaaacgatatccggcttcttcgggcagccttcgtcgtcaggcccaaagagcggt
tcaggcgcggctgggcgctaccagcctcagggcaaccgaagagatgccgtagggcaaacg
cgtcacagcggatcgtcgaactctgagtttaaaagtgtgatcccatcgaatctccggacg
tatcgaccgcaagggccaaagttgcaatcgcctcgaccggttctcgaaccttccgacccg
aatcaatacacctggttggcggcatcctcgaagccctcggagggacagaagctgttctcg
cgcgccactcagggaccgaaattgacagacgaaggaacaagcgaagctgggaaggatttg
cggacaagcgagattaagagtctttcaggaaccgtcgggggagccagaccggtggccacg
tatcacacgacaaccatgtcgatggtgcagacagggcccgcgacgacgatgcgacggacg
ctagggattcgacgaagcatgaatggatgggcggatcgcatgaagagggagaacaatgga
ccatcctcatag

DBGET integrated database retrieval system