KEGG   Aspergillus niger: ANI_1_2080024
Entry
ANI_1_2080024     CDS       T01030                                 

Symbol
An02g14980
Name
(RefSeq) replication factor A protein 1
  KO
K07466  replication factor A1
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
ang03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_2080024 (An02g14980)
   03420 Nucleotide excision repair
    ANI_1_2080024 (An02g14980)
   03430 Mismatch repair
    ANI_1_2080024 (An02g14980)
   03440 Homologous recombination
    ANI_1_2080024 (An02g14980)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ang03000]
    ANI_1_2080024 (An02g14980)
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_2080024 (An02g14980)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_2080024 (An02g14980)
Transcription factors [BR:ang03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    ANI_1_2080024 (An02g14980)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    ANI_1_2080024 (An02g14980)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     ANI_1_2080024 (An02g14980)
   MMR (mismatch excision repair)
     ANI_1_2080024 (An02g14980)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     ANI_1_2080024 (An02g14980)
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon CDC24_OB3 DUF223
Other DBs
NCBI-GeneID: 4980037
NCBI-ProteinID: XP_001400627
UniProt: A2QFL6
AA seq 606 aa
MSSEAASQVSVGALSAIFDDTKPQTREPVVQCVQIKPLPAQQSHPERYRAVFSDISNYVQ
TMLATQLNPMVSSKLLRKGCFVRLKSFQANSVKGKKILIILDLEVLEGLGEAEKIGDPKP
LESKTDEDEKHQPTTISSNGFYGSKISGAQVQSNTGVQSARPVLAATHATIYPIEAISPY
SHKWTIKARCTSKTNIRTWHNRNTEGRLFSVNLLDDSGEIRATGFNDQCDMLYDVFQEGG
VYYISNCRVQIAKKQFTNLNNDYELTFERDTVVEKAEDQTDVPQVRFNFTSIGDLQSVEK
DTTIDVIGVLKEAMDVTQITSKTTNKPYDKRELIMVDNTGFSVRLTIWGSTAQKFNASPE
SVIAFKGVKVSDFGGRSLSLLSSGSMAVDPDIEEAHKLKGWYDAQGRDENFSSHASLLGT
ASSTMKSDQFKTIAQIREEQLGMSEEAVYFSLKATVIYIKQDNMSFAYPACLSEGCNKKV
TELDPGQWRCERCDKTHPQPDYRYIMHVNVSDHTGQLWLSCFDDVGRSMMDISANQLMEL
FQTDEKAAGDVFQDANCRTWNFRCRAKIDHFGEQQRIRYQVSSAKPINYSHEAGRLADLI
GSYTVS
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgtcttcagaagcagcatctcaagtctccgttggggcactcagcgctatcttcgatgat
acaaagcctcaaacgcgtgagcctgttgttcagtgtgtccagataaagccattgccagct
cagcagagccacccggaacgctaccgagctgtattcagtgatatttcaaattatgtgcag
acgatgcttgcgacccaattgaaccccatggtttctagtaagctattacggaaggggtgt
ttcgttcgcctgaagtcattccaagcgaactccgtgaaaggcaaaaagattcttattatt
ctcgaccttgaagtcttggagggactaggagaggccgagaagattggcgatccgaaacca
ctcgaaagtaaaacagatgaagacgagaagcaccagcccactacaatctccagcaatggt
ttctatggatcgaagatatcaggagcacaggtccagtcaaataccggagtgcagtcagca
cgacctgttttggccgcaacgcatgctactatatatcccatcgaagctatttcaccatat
tctcacaaatggacgatcaaagcacgctgtacgagcaaaacaaatattaggacctggcac
aacaggaataccgaagggaggctcttcagcgttaatctactggacgacagtggcgaaata
cgagctactggatttaatgaccaatgcgatatgctgtatgacgtcttccaggagggcggt
gtatactatatttccaactgccgcgtgcagattgcgaaaaagcagttcacgaacctgaac
aatgattatgagctcactttcgaaagggatacggtggttgaaaaggcagaggatcagacc
gatgttccccaagttcgattcaatttcacttctatcggtgacctccaatcggtagaaaaa
gatactacaatcgatgtgataggtgtactgaaggaggccatggatgttacacagatcaca
tccaaaactacaaacaaaccctatgacaagcgtgagctaatcatggttgacaatactggg
ttctccgttcgcctgaccatctggggctctacggcgcagaaattcaatgcctcgcccgag
tctgtgatagctttcaaaggtgtgaaggtctctgactttggtgggcgaagtctgagtttg
ctgagctcgggttcaatggcggttgatcctgacattgaggaagcccacaagctcaaaggc
tggtatgacgcacaaggtagggatgagaatttctcttcacatgcttccttattaggcaca
gcctcatcaacgatgaagtcggatcaattcaagaccatcgcccaaataagagaggagcaa
ttgggtatgtcggaggaggcggtttacttttcgctgaaagcaacagtcatctatattaag
caggataatatgtcttttgcttatcctgcttgtctctcagaaggttgcaacaagaaggtg
accgagcttgatcctggtcagtggcgctgtgagcgctgcgataagactcacccccaacct
gactaccgctacataatgcatgtcaatgtcagcgatcataccggccaactttggctgagc
tgctttgacgacgtgggcagatcgatgatggacatttcggccaatcagttaatggagctg
tttcaaacggacgaaaaagcagctggcgacgtattccaggatgccaattgccggacctgg
aatttccgatgccgtgccaaaatagaccatttcggcgaacaacaacgtatacggtatcag
gtatcctcggccaaaccgattaattattcccacgaggctggacgccttgctgatctgatt
ggatcttacactgtatcttga

KEGG   Aspergillus niger: ANI_1_2138074
Entry
ANI_1_2138074     CDS       T01030                                 

Symbol
An08g07600
Name
(RefSeq) possible replication factor-a protein
  KO
K10739  replication factor A2
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
ang03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ANI_1_2138074 (An08g07600)
   03420 Nucleotide excision repair
    ANI_1_2138074 (An08g07600)
   03430 Mismatch repair
    ANI_1_2138074 (An08g07600)
   03440 Homologous recombination
    ANI_1_2138074 (An08g07600)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_2138074 (An08g07600)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_2138074 (An08g07600)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    ANI_1_2138074 (An08g07600)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     ANI_1_2138074 (An08g07600)
   MMR (mismatch excision repair)
     ANI_1_2138074 (An08g07600)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     ANI_1_2138074 (An08g07600)
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon DUF11
Other DBs
NCBI-GeneID: 4983079
NCBI-ProteinID: XP_001392877
UniProt: A2QRY1
AA seq 288 aa
MDGGYNNYSSTYSGGGGGGGGFMPGEMNNSPSGGKSDYTNSTLRPITIKQALDAVQPYPE
APYQIDSAEISSICFIGQVRNISSQSTNVTYKIDDGTGEIEAKQWIDSMTADSMDTDDIN
NTKAATGRRDGKVELNGYAKVFGKLKSFGNKRFVGAHCVRPVKSLDEVHCHLLEASAVHL
FFTRGPPGGGASGAGGVGDVGAKGDAAMGGTGDDYGAGKNLPAMSPVAKRVYQLLRTEPQ
SNEGLHAQLIAAKLSLPMPDVARAGDELLTAGVIFSTVDEQTWAILEF
NT seq 867 nt   +upstreamnt  +downstreamnt
atggacggcggctacaacaactacagcagcacctacagcggcggtggtggcggcggcggc
ggcttcatgccgggcgagatgaacaacagcccatccggaggaaagtccgactacaccaac
tccaccctccgccccataaccatcaaacaagctctggacgcagttcagccatacccggaa
gcgccctaccaaatcgactccgccgaaatctccagcatctgcttcatcggacaagtacgc
aacatcagctcgcaaagcacaaacgtcacatacaagatcgacgacggcacaggcgagatc
gaagccaagcaatggatcgactccatgacggccgactccatggacacggacgacatcaac
aatactaaggccgccaccggcaggagagacggtaaggtagagttgaacgggtacgcgaag
gtgttcggaaagttgaagtcgtttgggaataagaggtttgtgggtgcgcattgcgtccgc
cctgttaagagtctggatgaggtgcattgtcatttgttggaggcgagtgctgtgcatttg
tttttcacgagggggccgcctgggggtggtgcctctggtgctgggggagtgggtgatgtg
ggtgctaagggggatgcggcaatgggaggtacaggggatgactacggggctggaaagaat
ctgcctgctatgagtcctgttgcgaagagagtgtatcaattgcttaggacggagccgcag
agcaatgaggggttgcatgcgcagttgattgcggcgaagctgagtttgccgatgccggat
gtggccagggcgggagatgagttgctcactgcgggtgtgatcttttcgacggtggatgag
cagacgtgggcgattttggagttttaa

DBGET integrated database retrieval system