KEGG   Aspergillus niger: ANI_1_2152074
Entry
ANI_1_2152074     CDS       T01030                                 

Symbol
An08g07830
Name
(RefSeq) UV-damaged DNA binding protein
  KO
K10610  DNA damage-binding protein 1
Organism
ang  Aspergillus niger
Pathway
ang03420  Nucleotide excision repair
ang04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    ANI_1_2152074 (An08g07830)
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_2152074 (An08g07830)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ang04121]
    ANI_1_2152074 (An08g07830)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_2152074 (An08g07830)
Ubiquitin system [BR:ang04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Adoptor protein
     ANI_1_2152074 (An08g07830)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      ANI_1_2152074 (An08g07830)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      ANI_1_2152074 (An08g07830)
SSDB
Motif
Pfam: MMS1_N CPSF_A DUF1659
Other DBs
NCBI-GeneID: 4983102
NCBI-ProteinID: XP_001392900
AA seq 1124 aa
MAYVVPIHRASSIRNALKLHFMNAEEEALVVAKANRLEIYSLTPEGLNLAASCSLFAKVT
MLARLPAPANSPTDHLFVGTDRYTYCTLSWDGERNQIRTERNYVDISDPSSREAQTGNRC
LIDPSGRFMTLEVYEGVIAVVPIVQLPSKKRGRQVAPPSGPDAPRVGELGEPTTARIDEL
LALLYEDNQKKVRLKVRALHYSAATASTGADAAFEESLDGFSQELDLGASHLIPVPAPLG
GLLVLGETSIKYVDTDSNEIVSRPLDEATIFVAWEQVDSQRWLLADDYGRLFFLMLVLDS
NNQVQSWKLDHLGNTARASVLIYLGGGVIFVGSHQGDSQVLRIGNGSLEVIQTLSNIAPI
LDFTIMDLGNRTSESQTHEFSSGQARIVTGSGAFDDGTLRSVRSGVGMEELGVLGEMELI
TDLFGLQLATKGGYLDTLLVTFVDETRVFQFNFDGEVEELDSFLGLSLSENTLLAMNLPG
GRILQVTEQRVLIADIEGGMVTNEWTPPDNLVITSASANNDSIVLVSGGQLMTVLDINND
VRVISQKDFGADSQISGVTVPLSSAGVCIVGFPQLAKVSVLDLGRLSELHTTSLGPAGEA
FPRSVLVADVLANSPSTLFISMADGSVITYSFDARNYSLTGMNRLILGSEQPTFKKLPRG
DGLYNVFATCENPSLIYGSEGRIIYSAVNSEGASRVCHFNSEAYPGSIAVATRHDLKIAL
VDKERTTQIQTLPMGETARRVAYSPSEKAFGIGTIERKLKDGAEMVQSRFVLADEIMFRR
LDAFDLRPEELVESVIRAEFSAGKDENGRDVFKDRFVVGTAYLDDENEESIRGRILVFEI
DNGRKLTKVAELPVKGACRALAMLGEKIVAALVKTVVIYGVVNNDFGAMKLEKLASYRTS
TAPVDVTVTGNVIAVADLMKSVCLVEYSEGENGSPDSLTEVARHFQTVWATGVSCIAKDT
FLETDAEGNLIVLRRNLTGVEEDDKRRLEVTGEISLGEMVNRIRPVNIQQLASVTVTPRA
FLGTVEGSIYLFAIINPEHQDFLMRLQATMAGKVESLGNIPFNEFRGFRSMVREAKEPYR
FVDGELIERFLTCEPSLQEEIVDSVGMMNVDEVKIMIEALRRLH
NT seq 3375 nt   +upstreamnt  +downstreamnt
atggcttacgtggtgccgattcatcgggcgagtagtattcggaatgcgctcaagttgcat
ttcatgaatgcggaggaggaggcgctggttgttgcaaaggcgaaccgtctcgagatatac
tcccttacgccggaagggctgaacctggcagcgtcatgttctctcttcgcgaaagtgact
atgctagctcggcttcctgcgcccgcgaactcgcctacggatcatttgtttgttgggacg
gatcgatacacctattgtacgttatcgtgggatggggagaggaatcaaatccggacggag
aggaactacgttgatatatctgatccgtcgtcgcgggaggcgcagacgggaaatcggtgc
ttgattgatcctagtggacggtttatgacgctcgaggtctacgagggtgtcattgctgtt
gtgccgattgtgcagttgcccagtaagaagagggggagacaggtcgctccgccttcggga
ccggatgcgcctcgggttggggagttgggcgagccgacgacggcgaggattgatgagctg
ttggcgttgctctatgaagataatcagaagaaagtaaggcttaaggttcgcgcgttgcat
tatagtgcggcgacggcgagtacgggggccgatgcggcgtttgaggagtcgctggatggg
ttttcgcaggaattggatctcggagcgtcgcatctcataccggttccggcgcctttaggt
ggtctgcttgttttgggagagacgtccatcaagtatgtcgatacggatagtaacgagatt
gtgtcgcgtcctttggacgaagcaacgattttcgtggcttgggagcaggtagatagtcag
agatggcttctagctgatgattatggaagactgtttttcctgatgctagtcctggattct
aacaaccaagtacaatcctggaagctagatcacttagggaataccgctagagcctcggtg
ctgatatatctcggtggcggagttatcttcgtaggatctcaccaaggggattcgcaagtt
cttcgaatcggcaatggctcattggaggtcatccagacgctctccaatattgcgcccatt
ctcgactttaccatcatggatcttggaaatcgtaccagcgaaagccagacacacgagttt
tcatcaggccaggctcgcattgtgaccggttcgggggctttcgatgacggaacccttagg
agtgtacgcagtggtgtcggcatggaagagctcggcgtgcttggtgaaatggagctcatc
acggacttgttcggactgcagcttgcgacaaagggtggttatctggacactcttctggtt
accttcgtcgacgagacacgagtttttcagttcaactttgatggcgaggttgaagaattg
gacagcttccttggtctcagcctttcagagaatacacttctcgctatgaatcttcctgga
gggaggatcttgcaggtcaccgaacagagagttctcatcgcagatatcgaaggcggcatg
gttaccaatgaatggaccccgccggacaatttagtgatcacttctgcttctgctaacaat
gattcgatcgttctcgtcagcggcggccaacttatgacggtcctcgatatcaacaatgat
gttcgggttatatctcagaaggactttggagcagacagccagatttcaggagtcacggtg
cccttgtcttcggccggagtctgtatcgttggtttccctcaattggcaaaggtctcggta
ctggaccttggccgtctatcggagctccatacaacgtcgctgggcccagctggtgaagct
ttcccacgatccgtacttgttgccgatgtccttgcaaatagcccttccaccctcttcatt
tcgatggcagatggcagcgtcatcacctactccttcgacgcacgtaactactccttgacc
ggaatgaacaggctcatacttgggtccgagcagcctaccttcaaaaagctgcctcgaggc
gatgggctgtataatgtctttgccacatgcgagaaccccagcttaatatacggctctgag
ggtcgcattatctactctgcggttaattcggagggtgcgtctcgggtatgtcacttcaac
tcggaggcgtatcctggatcgattgcggtggccaccaggcacgacttgaagattgctctc
gtggacaaggagaggacaacacagatccagacgcttcctatgggcgaaactgcccgtaga
gttgcatattcaccgtctgaaaaggcttttggtatcggcaccatagagcgcaaattgaag
gacggggctgagatggtccaaagccggtttgtgttagctgatgagatcatgttccgtcgt
ctcgacgcctttgatcttcggccggaggagttggtcgagagtgtcattcgcgcggaattc
tctgcgggcaaagatgaaaatggtcgggacgtattcaaagatcggttcgttgtgggaaca
gcatatttggatgatgaaaacgaagagtcaatccgaggtcggatcttagtcttcgaaatt
gacaacggtcgaaaattgaccaaagtcgccgagttgcctgtcaaaggtgcatgccgcgcg
ttggctatgctcggagagaagattgtagccgctcttgtgaaaacggtcgtcatctatgga
gtggtgaacaacgactttggcgcgatgaagctcgagaagttggccagctaccgcacatcc
accgcccccgtcgacgtgaccgtaacgggtaacgtgattgccgttgccgacctcatgaag
agtgtatgtctggtggagtacagcgagggcgagaatgggtcgcccgatagcttgacagaa
gtggctcgccactttcagaccgtttgggccaccggtgtctcctgtattgctaaggacaca
ttcctggaaactgacgccgaaggtaacttaattgttcttcgacgcaacttgaccggcgtg
gaggaagacgacaagcgcaggctcgaagtaactggggagatctcgttgggcgaaatggtc
aaccgcattcgaccggtcaatattcaacaattggcgagtgtgacggtcactccgagggct
tttctgggcacagtggaaggttccatctatctctttgctattatcaacccagagcaccag
gacttcttgatgcgtctgcaggcaaccatggcgggcaaggtcgagtcgctgggaaacatt
ccattcaatgagttccgtggtttccgcagcatggtgcgagaggctaaagagccgtaccgc
tttgtggatggcgagctgattgagcggttcttgacctgcgagccaagtctccaggaagaa
attgtggactcagtgggcatgatgaacgttgatgaagtaaagattatgatagaagccctg
cgcaggctacattga

DBGET integrated database retrieval system