KEGG   Aspergillus niger: ANI_1_2322024
Entry
ANI_1_2322024     CDS       T01030                                 

Symbol
An02g02280
Name
(RefSeq) DNA mismatch repair protein (Pms1)
  KO
K10858  DNA mismatch repair protein PMS2
Organism
ang  Aspergillus niger
Pathway
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    ANI_1_2322024 (An02g02280)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_2322024 (An02g02280)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     ANI_1_2322024 (An02g02280)
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 4978714
NCBI-ProteinID: XP_001399369
AA seq 1055 aa
MNMATIKAIEARSIHQIQSGQVIVDLCSVAKELVENSLDAGATSIEIRFKNNGLDLIEVQ
DNGSGISPDNYANVALKHYTSKLSSYEDLTTLHTFGFRGEALSSLCALSDFRITTAQANQ
APKATRLDFEPSGKLKKTQIVAGQKGTTASVESIFKGLPVRRRELEKNIKREYGKVLNLL
HAYACVSTGVRFSVRNSVGKTKNVVVFSTNGNQTTKENIANVYGAKTLLALIPLDLALEF
EPSAAAGRRITGSGELNKLTVRGHVSKPVFGEGRQTPDRQMFFVNSRPCGLPQIAKAFNE
VYKSFNVSQSPFVFADFHMDTNAYDVNVSPDKRTILLHDAGALIDSLKESLVQLFESSDQ
TVPQSLVVGSKPAPTLKQRLGSLQTQTQSPNRPAVEDADSSAADDREPVGSQGTGEVQSS
SQDRMKSFLSGLGARGSSPVVSSPAGRGASSVRDQPMPSSPQDHPEPMEEDNDLFVRQDS
PAEPQPPTQGEIAEEAPRQREDNNSSQDTAPKEPSVSMQVVDPLEETPNTIQNAFDRMRP
RRMPPEMATITIGNRTVTSMVGSGLPRKRSVGAGDATGPTTRRRRIHTPSHPSIFGKHMR
DFAAPGSQLDPESEDEEILDEEAEDAIEESEEEEEPEEQESEIEDEEEDDESQSYTPSNH
EDDQPPEDVSSEHHHHEASNGNEPQSSQQLGSSEHNISEEEKKRHEEAEVQRLIQEAEDR
AALPQGNNIHRANKMNKGAAHRDSTVQLMSTIDGSLSKIRSQLGQLQESLRRWEEHHGPS
QSEDETAAPQETAEERLSLTVSKDDFANMRIVGQFNLGFILATRSSTDDSGPGSSAKDEL
FIIDQHASDEKFNFERLQAETVVQNQRLVQPKRLDLTAVEEEIVIENQAALEKNGFIVEV
DESGDEPIGRRCKLVSLPLSKEVVFGVRDLEELIVLLSETPTNAARSATGMYIPRPSKVR
KMFAMRACRSSIMIGKTLTVKQMQKVVQNMGTIDKPWNCPHGRPTMRHLMSLGQWNEWDE
LDDEEDQPVDSLDIWRGFYQEMAAHSEEEAEEAEE
NT seq 3168 nt   +upstreamnt  +downstreamnt
atgaacatggcgaccatcaaggccatcgaggcccgctcaatccatcaaatccaatccggt
caagtcattgttgacttgtgctccgttgcaaaggaactggtcgaaaacagtctcgatgcc
ggagcaacctcgatagaaatccgcttcaaaaacaatggcttagacttaatcgaagtccaa
gacaacggcagcggaatctcccccgataactacgccaacgtcgcattaaagcactacacc
tccaaactctcctcctacgaagacctcaccacgcttcacaccttcggtttccgtggcgaa
gcgctatcttccctatgcgcattatccgacttccgcattaccacggcgcaagcaaaccaa
gctcccaaagccacccgacttgatttcgaaccctccgggaaattgaaaaagacgcagatc
gtcgcggggcagaaaggcacgacggcctcggtggagagtatcttcaagggattgccggtg
cgacggcgggagctggagaagaatatcaagcgcgaatatggcaaggtcttgaacctgtta
catgcgtatgcgtgcgtcagcacaggggtgcgcttcagcgtccggaattcggtgggcaaa
acgaagaatgtggtcgtgtttagcacgaacggaaatcagacgaccaaggagaatattgcc
aatgtgtatggggcgaagacacttctggcgctgattccgctggatttggcactggagttt
gagccgtctgctgcggcagggaggagaatcactgggtctggggagttgaacaagctcaca
gttcgcggacatgtctcgaaaccggtatttggggaggggagacagacaccggatcggcag
atgttctttgtgaattctcggccgtgcgggttgccgcagattgcaaaggcgtttaatgag
gtgtataagtcgttcaacgtgtctcagtcgccgtttgtgtttgcagatttccatatggat
acaaacgcttatgacgttaatgtgtcgccggataagcggaccattctgttgcatgatgcg
ggagcgctgattgattcgctgaaggagtcgcttgtgcaattgtttgagtcgtcggatcag
acggtgcctcagtcgttggttgtggggtcgaagcctgcccctaccctcaaacaacgcttg
ggaagcttgcagactcagactcagagtccgaaccggcctgcagtggaggatgcggactcc
tcggcggctgatgatcgggaacctgtgggaagccaggggaccggtgaagtacagtcgagc
tcacaggatcggatgaagagcttcttgagcggtcttggtgcccgtggcagcagcccagtt
gtctcctcccctgcaggccggggtgcatcaagcgtacgagaccagcctatgccttcgtca
cctcaggatcatcctgaaccgatggaagaggacaatgacctcttcgtaagacaggactct
cctgccgagccacagcctcccacacaaggggaaatcgcggaagaagctcctcgacagcgt
gaagataataactcgtcacaggacacagctcctaaagaaccctcggtgtcgatgcaggta
gtcgaccctttggaggagacaccaaatactatccaaaatgcgtttgatcgcatgcgacca
aggcgaatgcctcctgagatggctaccattactatcggcaacaggaccgttacatctatg
gtgggaagtgggttgcccagaaagcgatctgtaggtgccggtgatgccactggccctacg
acacgtagaagacggatacacaccccttctcaccctagcatattcggcaagcacatgaga
gattttgctgctccaggctcgcaattggacccggagagtgaggacgaggaaatcctggat
gaggaagcagaagatgcaattgaggaaagcgaagaggaagaagagcctgaagagcaagaa
agtgaaatcgaggatgaagaggaagatgatgaatctcaatcttatacgccgtcaaaccat
gaagatgatcaacctcccgaagatgttagcagtgaacaccatcaccacgaagccagcaat
ggtaatgaacctcaaagttcacaacaacttggctcctcggagcacaacataagcgaagaa
gaaaaaaagcgccacgaagaagccgaagtccaacggctcatccaggaagcggaggacaga
gcagcattgccacagggcaacaatatccatcgtgcgaacaagatgaataagggagctgct
caccgcgactctactgtgcagctaatgagtactatcgatggctctctttctaagatacgc
tcacaactagggcagctacaggaaagccttcgtcgttgggaagagcaccacggtccctcc
cagagtgaagatgagacagcagcgccacaagaaacggcagaggaaagactgtctctaacg
gttagcaaagacgactttgccaacatgcggattgtcgggcagttcaatctagggttcatc
ctggctacgcggtcatccaccgatgactcggggcctggatcatcagcaaaagacgaactc
ttcatcattgaccagcatgcatctgatgaaaagttcaacttcgaacgactgcaggcagaa
accgtggtgcagaatcagcgcctcgtccaaccgaagcgcctcgatctcaccgcagtagag
gaggaaattgtcattgagaaccaagccgcgctggaaaagaacggctttattgtagaagtg
gacgaaagcggagacgagcctatcgggcgccgctgcaagttagtctcgctgcctttgagc
aaagaagtggtctttggggttcgggatctggaggagctcattgtccttttgtcggagaca
cctaccaacgctgcacggtcagcgacagggatgtatataccgcgtccgagcaaagtgcgg
aagatgttcgccatgcgggcctgtcggtcgagcatcatgattggcaagactttgacggtc
aagcagatgcagaaggtggtgcagaacatgggcaccatagataagccgtggaactgtccc
catggccggccgactatgagacacttgatgagtttggggcaatggaatgaatgggatgag
ctggatgacgaggaagaccaaccggtagattccttggatatatggcgagggttttaccag
gaaatggctgcacatagtgaggaggaggctgaggaagcggaggagtag

DBGET integrated database retrieval system