KEGG   Aspergillus niger: ANI_1_294154
Entry
ANI_1_294154      CDS       T01030                                 

Symbol
An17g02100
Name
(RefSeq) E3 ubiquitin-protein ligase RBX1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
ang  Aspergillus niger
Pathway
ang03420  Nucleotide excision repair
ang04111  Cell cycle - yeast
ang04120  Ubiquitin mediated proteolysis
ang04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ANI_1_294154 (An17g02100)
   04120 Ubiquitin mediated proteolysis
    ANI_1_294154 (An17g02100)
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_294154 (An17g02100)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    ANI_1_294154 (An17g02100)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ang04121]
    ANI_1_294154 (An17g02100)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_294154 (An17g02100)
Enzymes [BR:ang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     ANI_1_294154 (An17g02100)
Ubiquitin system [BR:ang04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   ANI_1_294154 (An17g02100)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     ANI_1_294154 (An17g02100)
   ECV complex
     ANI_1_294154 (An17g02100)
   Cul3 complex
     ANI_1_294154 (An17g02100)
   Cul4 complex
     ANI_1_294154 (An17g02100)
   Cul7 complex
     ANI_1_294154 (An17g02100)
   Cul9 complex
     ANI_1_294154 (An17g02100)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      ANI_1_294154 (An17g02100)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      ANI_1_294154 (An17g02100)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 FANCL_C zf-C3HC4_3 Zn_ribbon_17
Other DBs
NCBI-GeneID: 4989533
NCBI-ProteinID: XP_001398439
UniProt: A2R9P0
AA seq 119 aa
MADVEMKEAGSAAVKAKGSSKASEGASDGKKKFEVKKWNAVALWAWDIVVDNCAICRNHI
MDLCIECQANQGSSTTEECTVAWGICNHAFHFHCISRWLKTRQVCPLDNRDWEFQKYGR
NT seq 360 nt   +upstreamnt  +downstreamnt
atggcggatgtggaaatgaaagaagccggctccgccgccgtcaaagcgaagggctcatcg
aaagcttccgaaggtgccagtgacggcaagaagaagtttgaggttaagaagtggaacgcg
gtcgccctgtgggcgtgggatatcgtcgtcgacaactgcgcaatttgccgtaaccacatc
atggatctctgtatcgagtgccaagccaaccaaggttcgtctacgactgaggagtgtaca
gtcgcttggggtatctgcaaccacgcgttccacttccactgcatctcgcgatggctgaaa
acccgtcaagtttgtcccctcgacaatagggactgggagttccagaagtacggccggtaa

DBGET integrated database retrieval system