KEGG   Aspergillus niger: ANI_1_376164
Entry
ANI_1_376164      CDS       T01030                                 

Symbol
An18g03030
Name
(RefSeq) DNA mismatch repair protein Mlh1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
ang  Aspergillus niger
Pathway
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    ANI_1_376164 (An18g03030)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_376164 (An18g03030)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     ANI_1_376164 (An18g03030)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c ROKNT
Other DBs
NCBI-GeneID: 4989865
NCBI-ProteinID: XP_001398763
AA seq 723 aa
MDQQMDLDNMEPRGTKRSAEDSEEPQRPKRIRALDPDVVNKIAAGEIIVAPMHALKELIE
NAVDAGSTSIEILVKDGGLKLLQITDNGHGIDRDDLPILCERFTTSKLKQFEDLSSIGTY
GFRGEALASISHIAHLTVTTKTAGSSCAWRAHYSDGKLSAAPKATAGRGGTQITVEDLFY
NVPTRRRAFRSASEEYAKILDVVGRYSVHCSGVAFSCRKHGDSGVSVSTPAAANTIDRIR
QIHGSAVANELVKFNVEDEKLGFRSSGFATNANYHVKRTTILLFINHRSVESTAIKRAVE
QTYSSFLPKGGHPFVYIDLEIEPQRVDVNVHPTKREVNFLNEDEIIECICNEIRSKLAQV
DSSRTFLTQTLLPGVTTMEPANRDPEGTDTVPKTPSTTKKPYEHNLVRTDSKVRKITSML
TPATPHTPTASQADTTVLDEGLQYETTSREPHRISFTSVKNLRASVRNAMHNTLTETIAS
HTYVGLVDERRRIAAIQSGVKLYLIDYGMFCTEFFYQIGLTDFANFGVIKLSPPPKLIDL
LRIAADTERNQSSQESTTTEEANEIFTNAPDLVAETLIDRREMLNEYFSLDISPEGDLLS
IPLLLKGYLPSLGKLPRFLLRLGPYVDWANEEECFRTFLRELAAFYTPEQLPPPPKLQNG
NEAEGEGEGEDEFITQRRAQMARMLEHVVFPALRARMVATTRLLRGVVEVADLKGLYRVF
ERC
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggatcaacagatggatttggacaatatggagcctcgaggcacgaagaggtctgcagag
gacagtgaggagccacagaggccgaagaggattagagccttagatcccgatgttgtaaac
aaaattgctgcaggggagattatcgtggctcctatgcatgcgctgaaagagctaatcgag
aacgctgtcgatgctggatcgacatcgatcgagattttggtgaaagacggtggattgaag
ctcctgcagattactgacaatggtcatggcatcgacagagatgacctgcccattctgtgc
gagagattcacaacatccaagctaaagcagttcgaagacctttcatccataggcacgtac
ggtttccgaggtgaagctttggcaagcattagccatattgcccatctgactgtgaccaca
aaaactgctggttccagctgcgcatggagagcacactatagcgatgggaagcttagtgct
gcgcccaaagcaaccgcgggacgcggcggcacgcaaataacagtagaggacctgttctac
aatgtaccgacaagacgtcgggcttttcgatcagcaagtgaagaatatgccaaaatcctc
gatgtagttggtcgatactccgtccattgctcaggcgtggccttctcctgccgcaagcat
ggtgattcaggcgtcagtgtctccactccagcagctgcaaatacaatagaccgaattcgt
caaattcatggcagtgcagtcgccaacgaacttgtcaaattcaatgttgaagatgaaaag
ctggggtttcgctcatctggctttgccacgaacgcaaactaccatgtcaaaagaactact
atacttcttttcatcaaccaccgctcggtcgaatccacagccatcaagcgagcagttgag
caaacatactccagcttcctccccaaaggaggccatccatttgtctacattgacctcgaa
attgaaccacaacgtgtcgacgtcaacgtacatcccacaaaacgcgaagtgaatttcctc
aacgaagacgaaatcattgaatgcatctgcaacgagatccgctccaagctggcccaagta
gactcaagccggaccttcctaacccaaaccctcctcccaggtgtaacaacaatggagccc
gcaaaccgcgaccctgaaggcacagacaccgtacccaaaacaccatccacgaccaaaaag
ccatatgaacacaacctcgtccgcaccgactccaaagtccgcaaaatcacctccatgctc
acccccgccacaccacacacgcccacagcctcccaagcagacacgaccgtcctcgacgaa
ggcctccaatacgaaaccacctcccgcgaaccccaccgcatcagcttcacatccgtgaag
aacctccgtgcctccgtacgcaacgcaatgcacaacaccctaactgaaaccatcgcctcc
cacacctacgtcggcctcgtcgacgaacgtcgtcggatcgcggccatccaatccggcgta
aaactctacctaatcgactacggcatgttctgcaccgaattcttctaccagatcggcctt
acagactttgccaacttcggagtcatcaagctgtccccaccacccaaactcatcgacctc
ctccgaatcgccgcagacaccgaacgcaaccaatcctcccaagaatcaacaacaacagaa
gaagccaacgaaatcttcaccaacgcccccgacctcgttgctgaaaccctcatcgaccgc
cgcgaaatgctaaacgagtacttctcccttgacatctcgcctgagggggaccttctctcc
atccccctcctcctgaaaggctacctccccagcctgggaaaactgccccgattcctcctc
agactaggtccctatgtcgattgggcaaacgaggaggaatgcttccgcacgtttctgcga
gagcttgcggctttttatacccctgaacagttgccaccgcctccgaaactgcagaatggt
aatgaagcagaaggggaaggagaaggggaagatgagtttattacgcagagacgggcgcag
atggcgcggatgctggaacatgtggttttcccggctctgagggcgcggatggttgctacg
acgcggctgctccggggggtggtggaggtggcggatttgaaggggttgtatagggtattt
gagcggtgttga

DBGET integrated database retrieval system