KEGG   Aspergillus niger: ANI_1_378154
Entry
ANI_1_378154      CDS       T01030                                 

Symbol
An17g00250
Name
(RefSeq) hypothetical protein
  KO
K06634  cyclin H
Organism
ang  Aspergillus niger
Pathway
ang03022  Basal transcription factors
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    ANI_1_378154 (An17g00250)
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_378154 (An17g00250)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ang03021]
    ANI_1_378154 (An17g00250)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_378154 (An17g00250)
Transcription machinery [BR:ang03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ANI_1_378154 (An17g00250)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     ANI_1_378154 (An17g00250)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C_2 DUF6284
Other DBs
NCBI-GeneID: 4989358
NCBI-ProteinID: XP_001398254
AA seq 200 aa
MIEDEIYRSSSQFRLWSFTEASLKQLRATTNSVASDRVRAALRRAQEARRSATSSTTGTP
APGSDAENKATEEKQIECLTPEEEQQVVDYYSEQIIQLGENYKPPLPTIVRATAIQYLRR
FYLTNSPMTYHPKQIMPCALFLATKTDNYYLSLRQFAEGVPESEMERLAKKRKLERGSET
KDLFGGELVTQRTKERQMEG
NT seq 603 nt   +upstreamnt  +downstreamnt
atgatcgaagacgaaatataccggtcatcctctcagttccgactgtggtccttcaccgaa
gcatcgctgaagcaattacgagcaaccaccaactccgtcgcgagtgaccgagtgcgagca
gctctacgaagagcacaagaggctcgaagatcagccacctcctccacgacagggacaccg
gcccccggaagcgatgcggagaacaaggcaacggaagagaaacaaatcgagtgcttgaca
cccgaagaagagcagcaagtcgtggactactactccgaacaaatcatacaactaggggag
aactacaagccaccacttcccaccatcgtgagagccaccgcaatccaatacctccgccgc
ttctacctcaccaactccccgatgacctaccaccccaaacaaatcatgccgtgcgccctc
ttcctcgccaccaaaaccgacaactactacctctccctacggcaattcgccgaaggcgtt
cccgaaagcgaaatggagcgtctagcgaagaagcggaagctagagcgggggagtgagacg
aaagacctcttcggaggggagttagtcacgcagcggactaaggagaggcagatggagggg
taa

DBGET integrated database retrieval system