KEGG   Aspergillus niger: ANI_1_438034
Entry
ANI_1_438034      CDS       T01030                                 

Symbol
An03g03720
Name
(RefSeq) DNA repair protein rad14
  KO
K10847  DNA-repair protein complementing XP-A cells
Organism
ang  Aspergillus niger
Pathway
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_438034 (An03g03720)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_438034 (An03g03720)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     ANI_1_438034 (An03g03720)
SSDB
Motif
Pfam: XPA_C YhfH CpXC XPA_N
Other DBs
NCBI-GeneID: 4980361
NCBI-ProteinID: XP_001390253
UniProt: A2QGL4
AA seq 370 aa
MVTEEQSAPPPERGMSTPGDLKRNPLTPEQLRRIENNRQKAIAIREQREAEQARAHNADP
SSTKGVKRTYSSMTASDPPATLRDAASTDNRPLDGIKPARNFTKFVEYDFSKITDTKGGF
LTEEDDRYNKALHVRDEKAEQKPAHMTQKEWERQQLLKNLHRDRAGPFEPGLSVLDERTR
QKTCRECGSLEIDWKWEEALRCCVCHACKDKFPEKYSLLTKTEAREDYLLTNPELQDEEL
LPHLERPNPHKSTWNNMMLYLRYQVEEYAFSAKKWGSPEALDAEFERRENEKKRRREVKF
KSKLEDLKKRTRVDAYRRSRQGATGGNFGDDLGGGGRHVHQWGRSVEDPKTGIGVKKCVD
CGMEVEELEF
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggtgacggaggaacagtcggctccgccacccgaacgcgggatgagcacgccaggcgat
ctcaagcggaatccgctaaccccagagcaattgcggagaatagaaaacaatcgccagaaa
gccatagcaatacgagaacaacgcgaagccgaacaagctcgagctcacaatgctgatcct
tcgtccaccaaaggtgtcaagcgaacctactcctccatgactgcctccgatcctccggcg
actctgcgcgatgcggcctctacagataatcgccccctagatggcatcaagccggcgcgc
aactttaccaaattcgttgaatacgacttctccaagatcaccgacacgaagggtgggttc
ttgaccgaagaggatgaccgctacaacaaagcccttcatgttcgggatgagaaggcggag
cagaagccagcgcacatgacgcagaaggaatgggagcgacaacagctgctaaagaatctc
catcgagatcgtgcaggacccttcgaaccggggctcagtgtgttggatgagcggacacga
cagaaaacgtgccgagagtgtggcagcttagaaatcgactggaaatgggaagaagcgctc
cggtgctgtgtctgccatgcttgcaaggataaatttccggagaaatacagtctacttacc
aagaccgaggcacgagaggactacctcctgaccaatcccgaacttcaggatgaggaactc
ctcccacacctggagcgcccgaatccgcataaatcaacgtggaataacatgatgctgtac
ctacggtatcaggtcgaagagtacgccttttccgccaagaaatggggctcacccgaagcc
ttggacgcggagtttgagcgacgcgagaatgagaagaagcgccggcgggaggtcaaattc
aagagcaaacttgaagaccttaagaagcgtacgcgagtcgatgcataccgacgtagccgg
caaggagcgaccggtggtaattttggagatgacctggggggtggtggacgacatgtacat
cagtggggaagatcggtcgaagatcccaagacggggattggggtcaagaaatgcgttgac
tgcgggatggaagtcgaagaactcgagttctaa

DBGET integrated database retrieval system