KEGG   Aspergillus niger: ANI_1_490144
Entry
ANI_1_490144      CDS       T01030                                 

Symbol
An16g03520
Name
(RefSeq) DNA mismatch repair protein msh-2
  KO
K08735  DNA mismatch repair protein MSH2
Organism
ang  Aspergillus niger
Pathway
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    ANI_1_490144 (An16g03520)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_490144 (An16g03520)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     ANI_1_490144 (An16g03520)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_II MutS_IV MutS_I Clusterin YojJ SUR7
Other DBs
NCBI-GeneID: 4988746
NCBI-ProteinID: XP_001397664
UniProt: A2R7H2
AA seq 945 aa
MSSRPDLKVDDEVGFIRFYRSISSSSDNDNNNNETIRVFDRGDWYSAHGAEAEFIARTVY
KTTSVIRNLGRSDTGGLPSVTMSVTVFRNFLREALFRLNRRVEIWGSASGRGGQWKLIKQ
ASPGNLQDVEEELGSVGGLNIEAGAPIILAVKISAKAGEARSVGVCFADASVRELGVSEF
LDNDVYSNLESLVIQLGVKECLVQMDAGRKDVELGKVRNIMDSCGIAVSERHSGDFGVRD
IEQDLTRLLRDERSAGTLPQTELKLAMGSAAALIKYLGVMTDPSNFGQYRLYQHDLSQFM
KLDSSALRALNLMPGPRDGSKSMSLFGLLNHCKTPVGSRLLAQWLKQPLMDKAEIEKRQQ
LVESFVMDTELRQTMQEEHLRSIPDLYRLAKRFQRKQATLEDVVRVYQVAIRLPGFVASL
ENVMDEQYQTPLEAEYTSKLRSHSDNLAKLEEMVETTVDLDALENHEFIIKPEFDESLRI
IRKKLDKLRHDMDSEHRRVGGDLDQEVDKKLFLENHRVHGWCFRLTRNEAGCIRNKREYQ
ECSTQKNGVYFTTSTMQALRREHDQLSSNYNRTQTGLVSEVVGVAASYCPVLEQLAGVLA
HLDVIVSFAHCAVHAPTPYVRPKIHPRGTGNTVLKEARHPCMEMQDDISFITNDVSLIRD
ESSFLIITGPNMGGKSTYIRQIGVIALMAQTGCFVPCSEAELTIFDCILARVGASDSQLK
GVSTFMAEMLETSNILKSATSESLIIIDELGRGTSTYDGFGLAWAISEHIVTEIRCFGLF
ATHFHELTALADRYPKSAKNLHVVAFIGDGTGNEEDSKDSKRDQVTLLYRVEPGICDQSF
GIHVAELVRFPEKVVNMARQKADELEDFTSSGAQEKESMSLDKYSQEEVEEGSALLKDML
LKWKEAIEAPGKDLTVEEKRQIMRDLVNSDPKLQANKVFQGIKAL
NT seq 2838 nt   +upstreamnt  +downstreamnt
atgtcatctcgaccagatctcaaggtggacgacgaagtcggcttcatccgcttctatcgt
tccatttcctcctcctctgacaatgacaacaacaacaatgagaccattcgagttttcgac
cgcggagactggtactccgcccacggtgccgaagctgaattcatcgcccgcaccgtctac
aaaaccacctctgtgatccgcaatctgggccgcagcgacacaggcggcctgccctccgtg
acgatgagcgtgactgtattccgcaatttcttacgcgaggcgctattccgactcaatcgg
cgagtggagatctggggctctgcgagcgggcgcggcggacagtggaagctcattaagcag
gcgagtccggggaacttgcaggatgtggaagaagaactggggagtgtaggtgggctgaat
attgaggctggagcgccgatcattctggctgtgaagatttctgcaaaggccggggaggcg
agaagtgtgggggtttgttttgcggatgcgagtgtaagggagttgggtgtgagtgaattc
ttggataatgatgtttattcgaatctggagtcgctggtcattcagctgggggtgaaggag
tgtcttgtgcagatggatgcggggaggaaggatgtggaattggggaaggtgaggaatatc
atggatagttgtgggattgccgtgtcggagaggcacagcggtgatttcggggttagggat
atcgagcaggacttgacgaggttgttgagggatgagaggtctgccgggacgctgcctcag
actgagttgaagttggcgatgggatccgcggcggcgttgatcaagtatctgggtgttatg
acggatccgtccaacttcggccagtatcgtctctatcagcatgatctgtcgcaattcatg
aagctggattcgtcggcgctgagggcgttgaatctcatgccgggtccgcgggacggatct
aagtcgatgagtttgtttgggttgctgaatcattgtaagacgccggtgggcagcaggctg
ctggcgcagtggttgaagcagccgctaatggataaagctgagattgagaagagacagcag
ctggtggagtcgtttgtgatggacacggaacttcggcagactatgcaggaggagcatttg
cgctcgatcccggatttgtatcgcttggcgaagcggtttcagaggaagcaggcgacactg
gaggatgtcgtgcgtgtttatcaggttgccattcgcctgccaggctttgttgcgtcactg
gagaatgtgatggatgaacagtatcagacgcctctggaagcggagtatacgtccaagctg
cgcagccattccgataacctggcaaagctggaggagatggttgagacgacggtggacttg
gatgcattggagaaccacgagttcattattaagccggagtttgatgagagcttgcgcatc
attcgcaagaagctggataagctgcgtcacgacatggactcggaacaccgtcgtgtgggc
ggggatctggaccaagaagttgacaagaagctgttcctggagaatcatcgtgtgcatggc
tggtgcttccgattgactcgcaacgaggcgggctgtattcgcaacaaaagagagtaccag
gagtgctcaactcagaagaacggtgtctactttacgacctcgacaatgcaggcgctccgt
cgcgagcacgaccagctgtcatctaactacaatcgcactcagactggtttggtgagcgag
gttgttggtgtggctgcctcctactgccctgtccttgagcagcttgctggcgttttggct
cacctcgatgtcattgtgagcttcgcgcattgtgccgtgcacgcccctacaccatatgtc
cgtcccaagattcacccgcgtggtactggaaacacggttctgaaggaggcccggcatcct
tgtatggaaatgcaggatgacatctcttttatcaccaacgacgtgtcgctcatccgtgat
gagtcttccttcctgatcattaccggtcccaatatgggtggtaaatcgacctacatccga
cagattggcgtcattgcgctgatggcccagactggatgcttcgtgccatgctccgaggcg
gagctgactattttcgactgcattcttgctcgtgttggtgcgagtgactcgcagctcaag
ggtgtgtcgactttcatggctgagatgcttgagacctccaacatcctcaagtccgcgacc
tcggagtcattgatcatcatcgatgaacttggtcgcggaacaagtacatacgatggattc
ggccttgcatgggctatctcagagcacatcgtcactgagattcgctgtttcggcctgttc
gcaacccacttccacgaattgacggccctggccgatcggtacccgaagtcagccaagaac
ctacatgtagtggcttttattggtgatggcacgggcaatgaggaggacagcaaagactcg
aagcgagaccaggttacgttgctgtaccgtgtcgaaccgggcatctgcgaccagtccttc
ggtattcacgttgctgaattggtccgctttccggagaaggtagtcaacatggcgcgacaa
aaggcagatgagcttgaggacttcacctcctctggggcacaggaaaaagagtccatgtca
cttgacaagtactcccaggaagaagttgaagagggcagtgctctcctcaaggatatgttg
ctgaaatggaaggaagctattgaggcacctggcaaggacctgacggttgaagaaaagcgc
cagatcatgcgcgatcttgtcaacagtgatccgaagttacaggcgaacaaagtgttccag
ggcatcaaagctttgtag

DBGET integrated database retrieval system