KEGG   Aspergillus niger: ANI_1_590184
Entry
ANI_1_590184      CDS       T01030                                 

Symbol
An04g03050
Name
(RefSeq) DNA mismatch repair protein Msh6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
ang  Aspergillus niger
Pathway
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    ANI_1_590184 (An04g03050)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_590184 (An04g03050)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     ANI_1_590184 (An04g03050)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV AAA_27 Shugoshin_C
Other DBs
NCBI-GeneID: 4990710
NCBI-ProteinID: XP_001401672
AA seq 1210 aa
MARGTPAASSPTTATPPTGALKRSTSSTQNMKNQKSILGFFQKSSPSTPSTARNAEPASS
PAERVSEQRRGSAKGAAERKKSVPKFKQELEPVPSSDLVIPEEDEQEDNAQESPNGKAEL
KTASPSRRAKKQVNYVESDSEGEDDDEKIFRPGRNSRNKRRKMSPESDDEFNDGGDVGYS
DDEMDDFIVADDSDEEAKPSKKRKRPSTQPKSKSSSLPPVSFEEDLDMDIPDASAGTALK
WTYDPESSEPRQPRTTPVTPKKSSGTTKQKAHVTEPEQRYAWLANIRDIDGHPIGHPEYD
PRTLYIPPLAWTKFSPFEKQYWEIKQKFWDTVVFFKKGKFYELYENDATIGHQLFDLKLT
DRVNMRMVGVPEMSLDHWANQFVAKGFKIARVDQIESALGKEMRERDGKKGGGKEDKVIR
RELSSVLTAGTLVEGSMLQDDMSTYCVAIKEALIDDKPAFGIAFVDTATGQFFLSEFVDD
VDMTKFETFVAQTRPQELLLEKSAVSQKALRILKNNTGPTTLWNYLKPVKEFWEADITVK
ELDVSEYFVSQDDDNLQAWPEALREARDKELVMSAFGALVQYLRLLKIERDLITIGNFTA
YDPIKKATSLVLDGQTLINMEIFSNSFDGGSEGTLFQLLNRCITPFGKRMFKQWVCHPLV
DANKINARLDAVDALNADPTVRDQFSSQLTKMPDLERLISRVHAANCKAQDFLRVLEGFE
QIEYTMSLLKESGSAGEGVIGQLISGMPDLNELLEYWKTAFDRSKARENSILVPKPGVEE
DFDSSQENIEQIHRDLESLLKRVRKELGSSAIIYKDNGKEIYQLEVPIKVKNIPKNWDQM
SATKQVKRYYFPELRKLIRQLQEAQETHSQIVKEVAGRFYARFDENYTTWLAAVRIVAQL
DCLISLAKASSSLGQPSCRPVFVDDERSVLEFEELRHPCLISSVGDFIPNDVQLGGTHAN
IDLLTGANAAGKSTVLRMTCVAVIMAQIGCYLPCQSARLTPVDRIMSRLGANDNIFAAQS
TFFVELSETKKILSEATPRSLVILDELGRGTSSYDGVAVAQAVLHHVATHIGALGFFATH
YHSLAAEFEGHPEIAPKRMRIHVDDEERRVTFLYKLEDGVAEGSFGMHCAAMCGIPDKVI
ERAEVAAKQWEHTSRLKESLERRKGGGLVGMGWWSDIAWALRETVAESEEGAQEVSDRSL
EVLRKAIEAL
NT seq 3633 nt   +upstreamnt  +downstreamnt
atggctagaggaacccccgccgcctcctctcccacgactgcgacgccgcccaccggagcc
ttgaaacgttccacgtccagcacccagaacatgaaaaaccagaagtcaattcttgggttc
tttcagaagtcatctccatccaccccgtccactgctcgcaatgcggagcctgcttcttct
ccggcggagagggtctcagagcagcgacgcggaagtgcgaagggcgcggcggaaaggaag
aagagcgttcctaagttcaagcaagaattggagccggtgcctagtagtgacctagtgatt
ccggaggaggatgagcaggaagataatgcacaggagagcccgaatggcaaagctgagctg
aagacagcatctccatcacggcgggccaagaagcaagtcaattacgtcgaatctgactcc
gaaggcgaagatgacgacgagaagatatttcgccctggccgtaacagcaggaacaagcga
aggaagatgtctcctgaaagcgatgacgagtttaacgatggtggagatgtcggctactcc
gatgatgaaatggacgactttattgttgcagacgattcggacgaagaagcgaagccatct
aagaagcgcaagaggccgtcgacacaaccgaagagcaagtcctcctctttaccgcctgta
tcatttgaagaggacttggacatggacataccagatgcatctgctggcacagctctgaag
tggacgtacgatccagaaagctccgaaccacgccagccgcgcacaacaccggttactcca
aagaaatcttcgggaactacgaagcagaaagcacatgtgacagagcctgaacaacggtat
gcctggcttgccaacatccgggacattgacgggcaccctatcgggcatcctgaatatgat
cctcgcaccctgtatatccctccactggcttggaccaagttctctccgttcgagaagcaa
tactgggagatcaagcagaaattctgggataccgttgtcttcttcaagaagggcaagttc
tacgaactttatgaaaacgatgctacaatcggacatcaactgttcgatctgaagctcacg
gaccgtgtgaacatgcgcatggttggtgtcccggagatgagtctggatcactgggccaac
caattcgtggccaagggtttcaagatcgctcgtgttgaccaaatcgagtcggccctgggc
aaggagatgcgcgagcgcgatggtaagaagggtggaggtaaagaagacaaagtcatcagg
agagagttgtcgtccgttctcacggctggtaccctcgtcgagggctccatgctgcaagat
gacatgtccacctactgtgttgctatcaaagaggctctgattgatgacaagcctgccttt
ggtattgctttcgttgatacagcaaccggccaattcttcctgtccgagtttgtggatgat
gttgacatgacgaagttcgagacattcgtcgcgcaaacccgaccccaggagcttcttttg
gagaagtctgcagtatctcagaaggctttgcgcatcttgaaaaacaacactggcccaact
acactctggaattacctgaagccggtgaaagagttctgggaagctgacatcacagtgaag
gagcttgatgtgagcgagtatttcgtctcccaggacgatgataacttacaagcttggccc
gaagcactccgagaagcccgcgacaaagaactggtcatgtccgcattcggtgctctagtg
cagtatctcaggctcctgaagattgagcgtgatttgatcaccattggaaacttcactgcg
tacgatccgatcaagaaggccaccagcctggtgctggatggtcaaactcttatcaacatg
gagatattctccaactctttcgatggcggctccgagggcaccttgttccagcttttgaac
cgctgtatcacaccttttggcaaacgcatgttcaagcagtgggtatgccatccgcttgta
gatgcaaataagatcaatgctcgcttggatgcagtggatgccctcaatgctgatcccact
gtccgggaccaattttcgtcccagctgaccaagatgcccgatttggagcgactaatctct
cgtgtccatgctgcgaattgcaaagcccaagacttcctgcgcgtcttggaaggctttgag
cagatcgagtataccatgagtctgctcaaggaaagtggctcagccggagaaggcgttatt
ggacaattgatcagtggcatgcctgacctgaatgagctgctcgagtactggaagactgct
tttgatcgctccaaggcgagagagaatagcatcctggtacccaagcccggtgtcgaggaa
gactttgacagctcccaggaaaacatcgagcaaatccaccgcgacctcgagagcctgctg
aagcgtgtacgcaaagagcttggatcttccgcaattatctacaaggacaatggcaaggag
atctaccagttggaggtgccaatcaaagtgaagaacatcccaaagaactgggatcaaatg
tctgctaccaaacaagtcaagcgctactatttcccggagctgcgcaagctcatccgtcaa
ttgcaggaggcccaagaaacacacagtcagatcgtcaaggaagtcgctggccgattctat
gcacgatttgacgaaaactacaccacttggcttgctgccgtccgcattgttgcccagctc
gactgcctcatcagtctggccaaggcctcctcatcgctcggacaacctagctgccgtcct
gtcttcgtcgacgatgagcgaagcgttcttgaattcgaggagctgcgccatccatgccta
atctcctcagttggcgatttcatccctaacgacgtccaactgggaggcacacacgcgaac
atcgacctcctcaccggagccaacgcagccggaaagtccaccgtcctccgaatgacctgc
gtcgccgtaatcatggcccagatcggatgttatctcccctgccaatccgcgcgcctcacc
ccagtcgatcgaattatgtcccgcctaggcgcaaacgacaacattttcgcagcccaatca
accttcttcgttgagctctccgaaaccaagaagatcctctccgaagccacaccccgctcg
ctcgtcatccttgacgaactaggccgtggaaccagctcctacgacggcgtggcggtcgct
caggccgtcctgcaccatgttgccactcatatcggcgctctcggattcttcgcaacccac
taccactccctggctgccgagttcgagggacatcctgaaatcgcaccgaagcgcatgcgc
atccacgttgacgacgaggaacgccgcgtcacgttcttatataagcttgaggatggcgtt
gcggagggcagttttggtatgcattgcgcggcgatgtgcggcattccggacaaggtcatt
gagcgggcagaggtggctgcgaagcagtgggagcatacaagccggttgaaggagagtttg
gagaggcggaagggaggtgggctggtgggaatgggatggtggagtgatattgcttgggcg
ttgagggagacggtggctgagagtgaggagggtgctcaggaggtgagtgaccgcagtttg
gaggtgctgaggaaggcgattgaggctttgtga

DBGET integrated database retrieval system