KEGG   Aspergillus niger: ANI_1_86124
Entry
ANI_1_86124       CDS       T01030                                 

Symbol
An14g00480
Name
(RefSeq) TFIIH and nucleotide excision repair factor 3 complexes subunit
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
ang  Aspergillus niger
Pathway
ang03022  Basal transcription factors
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    ANI_1_86124 (An14g00480)
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_86124 (An14g00480)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ang03021]
    ANI_1_86124 (An14g00480)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_86124 (An14g00480)
Transcription machinery [BR:ang03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ANI_1_86124 (An14g00480)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     ANI_1_86124 (An14g00480)
SSDB
Motif
Pfam: Tfb2 Tfb2_C Helicase_C_3
Other DBs
NCBI-GeneID: 4986902
NCBI-ProteinID: XP_001400677
UniProt: A2R2E7
AA seq 478 aa
MAAAPSSRPFEYLESLAGTVFYKLYQQPSTALAIFRRMLPDLAKCFVMALLYLKDPLPAA
DLEAWVKSESLKERDNALSILGRLHILSNTVTADNVRAYKVTDPFATSLRHALTGADQTQ
SFGVLSQVPAGSEVSIPELDEYARRQWEGVLGYMVGTGGMGGPQVTLSKGVKELLQAGHL
VEIRDRRVEITQDGFAFVLQDVSTQVWHILILYVESASAIKMDSVEVLSFVFLLSSLELG
KSYEKNHLSSKQLRMLTDLADFGIVYQESPDAPRFYPTRLATTLTSDSSALSNPLLGSLS
GPAGEASSKAGTGFIIIETNYRVYAYTSSPLQISLIALFTTLKYRFPNLITGKITRQSVR
RAVEMGITADQIISYLSTHAHPQMRKHNVSRSTSNQAGIPPSVLPPTVVDQIRLWQLERD
RVKATSGFLFKDFVSLAEYEAPCRYAEEIGVLAWKSDRKRMFFVTRHEQVAAFLRSRK
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggctgccgcaccatcttctcgtccctttgaatacctcgaaagccttgctggcactgtc
ttctacaaactttaccagcagccatcaacggctctcgccattttcaggcgcatgctgcct
gatctggcaaaatgctttgtcatggcacttctctacctaaaggatccgctccccgcggcg
gatctggaggcttgggttaaatcggagagcttgaaagaacgcgacaatgcactctccatc
ctaggaagactgcatattttatccaacactgttacggcggataatgtccgcgcctacaaa
gtcaccgatcccttcgccacttcattgcgacacgctctcaccggcgccgaccaaacacaa
tcttttggcgtcctttcacaagtgcctgctggctcggaagtctcgatccccgaacttgat
gagtatgcgcgacgacagtgggaaggagtgctgggatacatggtcggtactggaggcatg
ggaggtccccaagtgaccctcagcaaaggcgtgaaggagctcctgcaggcgggtcatctg
gtcgagatccgagatcgtcgcgtcgaaatcacccaggatgggtttgcctttgtcctgcaa
gatgtcagcacgcaggtgtggcatatcttgattctttacgtcgagagcgccagcgccatc
aagatggacagtgtcgaagtcctctcgttcgtgttccttctcagcagtctcgaactcgga
aaatcatatgaaaagaaccacctcagttcgaaacaactgcgcatgctgaccgaccttgcc
gactttggtatcgtctatcaagaatcgccggatgcaccgcgtttctaccccacccgtctt
gcaaccaccctcacgtccgactccagcgccttgagcaacccactcttgggttccctctcc
ggtcctgctggcgaagcctccagcaaagcgggtacgggcttcatcattatcgaaaccaac
taccgtgtatacgcatacacctcgtctcccctacagatctccctgattgctctgttcacc
acactgaaataccgcttccccaacctcatcaccggcaaaatcacccgccaatccgtccgc
cgggccgtcgagatgggcatcaccgccgaccaaatcatttcctatctctctactcacgcc
cacccgcaaatgcgcaagcacaacgtctcccgctcgacctcaaaccaggccgggatcccc
ccgtcagtcctcccgccaaccgtggtggaccagattcgactttggcagctggagcgggac
cgtgtcaaagctacgtccggattccttttcaaggactttgtcagtctggcagaatacgag
gcgccatgtcgctatgccgaagaaatcggtgttctggcatggaagtcggatcgcaaacgc
atgttcttcgtgacgaggcatgaacaagtggctgcgttcttaaggagccggaaataa

DBGET integrated database retrieval system