KEGG   Aspergillus niger: ANI_1_962104
Entry
ANI_1_962104      CDS       T01030                                 

Symbol
An12g07910
Name
(RefSeq) DNA repair protein RAD1
  KO
K10848  DNA excision repair protein ERCC-4 [EC:3.1.-.-]
Organism
ang  Aspergillus niger
Pathway
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_962104 (An12g07910)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ang03032]
    ANI_1_962104 (An12g07910)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_962104 (An12g07910)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     ANI_1_962104 (An12g07910)
DNA replication proteins [BR:ang03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    ANI_1_962104 (An12g07910)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     ANI_1_962104 (An12g07910)
SSDB
Motif
Pfam: ERCC4
Other DBs
NCBI-GeneID: 4986142
NCBI-ProteinID: XP_001395842
AA seq 948 aa
MPPERPNVPVKLSLPLQYQQDIFTELRSEDELVILARGLGLLRLVTNLLHFYDAAGNNLV
LVVGADDRENEWIGEALAEHYAISKTPLARGLKVINTDRATVPMREKIYSEGGILSVTSR
ILIVDFLSKLLDPEKVTGMVVLHADKIVATSIEAFIIRAYREHNKRGFLKAFSDAPEPFT
TGFAPLANSMRNLFLRKTSLWPRFHVTVAEALEGHRKAEVIELEVPMSDKMREIQNAVLE
SFDVAIRRQLDPIWHRVSFRTRQIVSDLSDLRAILHALLTYDAVSFLKYLDTIVTAHTPP
PGSTKHSYSPWLFLDAADVLFQTARSRVYQGRISNDVVRSSSTSFPTTLQPVLEEQPKWE
VVAEVLQEIETDAYLNPVNVDESNSTVLIMCSDQRTCRQLREYMGTMHANVSSKKQETRD
TLNPGDAIHEKKGSAEVMMRRRLRDYMDWKLSLSNVSKNFSSNPPGDGPQSPAVNSPGSL
NQGRAPMNKRRRVRGGGTPSVPARAPNSGIQVDIEPPAQVSALLEEIQPTEVEETQKEEI
IIDDLEDMDDYYELYDMDDLVIIHPYDGDMDEHILEEVRPRYIIMYEPDPAFIRRVEVYR
SSHVGRDVRVYFIYYGGSVEEQRYLSAVRREKDSFTKLIKEKSNMAVTITHDKSQVDPQE
QFLRTVNTRIAGGGRLAATASPPRVVIDVREFRSALPSLLHGNNMIIVPCQLTVGDYILT
PDICVERKSVRDLISSLRNGRLYNQAETMLQHYKNPLLLIEFDQNKSFTFDAFASATTPG
TTFLTDFGFSSSGTSTLSANSSLVNPSSPKSAQHLLVLLTLTFPRLKIIWSSSPYQTAEI
FAELKKNNPEPDPIRAVQTGLDMDIAASSHSGDIMAAAGIEHRVFNLLPQDMLRAVPGVN
PNILERLILETENIHEVANMSVEQLDPLIGIEAARKIVGFFRKSVFES
NT seq 2847 nt   +upstreamnt  +downstreamnt
atgccacctgaacgccccaatgtaccggtgaagctgtccttgcccttgcaataccagcag
gacatcttcaccgaactgcgctcggaggatgagttggtaatccttgctcgcggacttggc
ctcttacgcctggtaacgaatttgctacatttttatgatgctgcgggaaacaacttggtg
cttgttgttggcgcagatgatcgggagaatgaatggattggagaagccttggctgagcac
tatgctatcagcaaaacccctcttgccagggggctcaaggtgatcaatactgacagagcc
acggttccaatgcgcgagaagatctactccgaaggtggtatcctgagtgtaacatccagg
atactaatagttgactttctgtcgaagctgctcgaccctgagaaggtcactggtatggtc
gtgcttcatgctgataagattgtggcaacgtctattgaagccttcattatccgggcatat
cgagaacacaacaaacgtggattcctaaaagccttctccgacgccccggaaccattcacg
accggatttgctcctctggcgaattccatgcgcaatctcttccttcgcaaaacctccttg
tggccacgcttccatgtcaccgtcgcggaggctcttgaaggccatcggaaagcggaggtg
atcgaactggaagttccgatgagtgataagatgcgcgaaatccaaaacgctgtccttgag
tccttcgatgttgcaattaggcgccaactggatcccatatggcaccgtgtgagcttccgg
accagacagatcgtcagtgacttatcagaccttcgggcaattctccatgctttgctcacc
tatgacgccgtctcattccttaaatatcttgatacgatcgtcacagcacatactccgcct
cctgggtccacgaaacatagctattcgccatggctttttctcgacgcagccgatgtactt
tttcagaccgcaagatcaagagtatatcaggggcgtattagcaacgatgtagtccgctca
tcatccacgtcattccctaccacacttcagcccgttctggaagaacaaccaaaatgggaa
gtcgtggcggaggtcctgcaggaaattgaaacggacgcatacctcaacccagtcaatgtg
gacgagtccaacagtaccgtcttgatcatgtgcagtgaccaacggacctgtcggcaactt
cgcgagtatatgggcacaatgcatgccaacgtgagtagtaagaagcaggagacaagggat
acattgaatccaggtgatgccattcacgagaagaagggctctgctgaagttatgatgcgc
cgaaggctgcgggactatatggactggaagttatccttgtctaatgttagcaagaacttt
tcgtcaaaccccccgggtgacggtcctcaatcgcctgcggtgaactcacctggctctctg
aatcaaggaagagccccaatgaacaagcggcgccgagtccgggggggaggcactccatcc
gtcccagcacgcgcgccaaacagcggtatacaggtggatatcgaacctccggcgcaggtg
tcggcactcctagaggagattcagcctactgaggtcgaagagacccaaaaagaggagatc
attatcgatgatttagaagatatggacgattactacgaattgtacgatatggatgacttg
gtcatcatacacccttacgacggcgatatggatgagcatattctggaggaggttcggcct
cgatacatcatcatgtacgagccagaccctgcattcatccgacgagttgaggtctatcgc
agctctcatgttgggagggacgtgcgggtttattttatctactacgggggatctgtcgaa
gaacagcgctacttgagcgccgtacggcgtgagaaagactcgttcacaaagctcatcaaa
gaaaaaagcaacatggctgtcaccatcacacatgataagagccaagtagaccctcaagaa
cagttccttcgcaccgtgaacacccgcatcgcaggaggcggccgactagccgcaactgca
tcaccaccccgagtcgtgatagatgtgcgcgagttcagaagtgcccttccatccctgcta
catggcaacaacatgatcatcgtcccatgtcaactcacagtcggcgattacatcctcacg
cccgacatctgcgtagaacgcaaatcagtccgcgacctgatatcctctttacgaaatggc
cgtctctacaaccaagcagaaaccatgctccaacactacaagaacccccttcttctgatc
gaattcgaccaaaacaaatccttcaccttcgacgctttcgcctccgcaaccacccccggc
acaaccttcctcactgacttcggtttctcctcctccggcacaagcaccctatccgcgaac
agctccctcgtcaacccatctagccccaaatccgcccagcacttactcgttctcctaact
ctcacctttccccggctcaagatcatttggtcctcttccccctaccagacagctgaaatc
ttcgccgagctgaagaagaataatccagagccggatccgattcgggccgtccagacaggg
ctagacatggatattgcggcgtcgtcgcactctggcgatatcatggctgcggcagggatc
gagcatcgggtctttaacctcttgcctcaggatatgctccgggctgtgccaggtgttaat
cccaatatccttgagcggttgattttggagacggagaacatacatgaggttgcgaatatg
agcgttgagcagttggatccgttgattgggatagaagcggctcggaagatcgttgggttc
tttcgtaaaagtgtgtttgagagttga

DBGET integrated database retrieval system