KEGG   Aspergillus niger: ANI_1_992074
Entry
ANI_1_992074      CDS       T01030                                 

Symbol
An08g07060
Name
(RefSeq) DNA repair helicase rad15
  KO
K10844  DNA excision repair protein ERCC-2 [EC:3.6.4.12]
Organism
ang  Aspergillus niger
Pathway
ang03022  Basal transcription factors
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    ANI_1_992074 (An08g07060)
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_992074 (An08g07060)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ang03021]
    ANI_1_992074 (An08g07060)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_992074 (An08g07060)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ANI_1_992074 (An08g07060)
Transcription machinery [BR:ang03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ANI_1_992074 (An08g07060)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     ANI_1_992074 (An08g07060)
SSDB
Motif
Pfam: DEAD_2 HBB Helicase_C_2 ResIII DEAD SNF2-rel_dom DUF2492
Other DBs
NCBI-GeneID: 4983023
NCBI-ProteinID: XP_001392821
UniProt: A2QRS5
AA seq 801 aa
MKFFIDDLPVLFPYPRIYPEQYAYMCDLKKTLDAGGHCVLEMPSGTGKTVSLLSLIVAYQ
QHYPEHRKLIYCSRTMSEIEKALAELKALMKFRAKELGYTEDFRALGLTSRKNLCLHPSV
KREKSGAVVDARCRSLTAGFVKEKKERGEDVELCVYHENLDLLEPHNLVPPGVFTLDGLL
KYGEEHKQCPYFSARRMMPFCNVIIYSYHYLLDPKIAERVSRELSKDCIVVFDEAHNIDN
VCIESLSIDLTEDSLRKATRGANNLERKINEMKTSDAEKLQNEYSKLVEGLQAAEQAREE
DQFISNPVLPDDLLKEAVPGNIRRAEHFVSFLKRFIEYLKTRMKVMHTISETPPSFLTHV
KDLTYIERKPLRFCAERLTSLVRTLELINIEDYQPLQEVATFATLVATYEKGFLLILEPF
ESEAATVPNPVLHFTCLDAAIAIKPVFERFSSVIITSGTLSPLEMYPKMLGFNAVMQESY
SMTLARRSFLPMIVTRGSDQAQISSSFQIRNDPGVVRNYGNLVLEFSRITPDGVVVFFPS
YLYMESIISMWQGMGILDSIWNYKLILVETPDAQESSLALETYRTACCNGRGALLLCVAR
GKVSEGIDFDHHYGRAVINIGVPFQYTESRILKARLEFLRENYRIRENDFLSFDAMRHAA
QCLGRVLRGKDDYGVMVLADRRFQKKRNQLPKWINQAMLESETNLSTDMAAATAKNFLRT
MAQPFKARDQEGISTWSLADIERHREKQKLEEERALREVPPNLAYGAAAAAPHNGVRNGA
GGADEFEDEIDNEDLMMLDAQ
NT seq 2406 nt   +upstreamnt  +downstreamnt
atgaaattctttatcgatgatctccccgtccttttcccgtatcctcgtatctatcccgaa
caatatgcctacatgtgcgatcttaaaaagaccctcgatgccgggggtcactgtgtcctg
gagatgccctccgggaccggaaagacagtatccctcctctcgttgattgtcgcctaccaa
caacattatccggagcaccgaaagctcatctactgttctcgaaccatgtccgagatcgag
aaggccttggccgagctgaaggcgctgatgaagttccgggctaaggaacttgggtatacc
gaagattttcgcgcactcggtctgacaagtcgaaagaatttgtgtctgcatccgtctgtc
aagcgggaaaagagtggcgctgtcgtcgatgcaaggtgccggagcttaactgcaggcttc
gtcaaggagaagaaagagcggggtgaggacgttgaactttgtgtgtatcatgagaacctc
gatctgcttgagccgcacaacctcgttcctcccggtgtcttcaccctcgatggtctactc
aaatacggagaagagcataaacaatgtccttacttctcagcacggcgcatgatgcctttt
tgcaacgtcattatctactcttaccactacctgctggaccccaagatcgccgagagggta
tcgcgagagctttctaaggattgtatcgtggttttcgacgaggctcacaatattgacaac
gtctgtattgaatcgctaagtatcgacctaacggaggactcgttacggaaagcgacaagg
ggggcgaacaacctggaacgcaagatcaacgagatgaaaacttcggatgcggaaaagctg
cagaatgagtactcaaaactcgttgaaggcctacaggcagccgaacaagctagggaggag
gatcaattcatctcaaaccctgtccttccggatgatctgctcaaggaagctgtgccggga
aatattcgacgagcggagcacttcgtatccttccttaaaagatttatcgaatacctcaaa
actcgaatgaaagtcatgcataccatatccgaaacgcctccttccttcttaacgcacgtg
aaggatctgacctatatcgagcggaagccccttcgcttctgcgctgaacgacttacctcg
ctcgtgcgaaccctagagcttatcaacatagaagactaccaaccgctccaggaggtagca
actttcgcgaccctagtcgccacatacgaaaaaggattcctcctgatcttggagcctttc
gaatcggaagcagcaactgttcccaacccggtattgcatttcacctgcttagatgccgct
attgccatcaaaccagtgttcgaacgatttagctccgtcattattacttcaggaacgcta
tcccctcttgagatgtaccccaagatgcttggattcaacgctgtaatgcaggagtcttac
agcatgacacttgcgcgtcgatccttcttacccatgatcgtaacccgcggatccgatcag
gcgcagatatcctcatccttccaaattcgcaacgatcccggagttgtcagaaactatggc
aacctcgtcttggaattctcccgaatcacccccgacggtgtcgttgtcttcttcccctcc
tacctgtacatggaatccatcatcagcatgtggcaaggcatgggcattctcgactcaatc
tggaactacaaactgatcctcgttgaaacccccgacgcgcaagaatcctccctcgcccta
gaaacctaccgaacagcctgctgcaacggtcgaggcgccctcctcctctgtgtcgcacga
gggaaagtctccgaaggaatcgatttcgaccatcactacggccgtgccgtgatcaacatc
ggcgttcccttccaatacaccgagtcccgcatcctgaaagcgcgcctcgaattcctccgc
gaaaattatcgcatccgcgaaaatgacttcctctctttcgatgccatgcgtcatgccgct
caatgcttgggccgcgtcctccgcggaaaggacgactacggagtcatggtgctcgccgat
cgtcgattccagaaaaagcgcaaccagctccccaaatggatcaatcaggccatgctggaa
agcgaaaccaacctcagtaccgatatggcggcggctaccgccaagaacttcttgcggacg
atggcccagccgttcaaggctagggatcaagaaggaatctcgacatggagtttggctgat
attgaaagacatcgagagaaacagaagttggaagaggaacgggctctgcgagaagtacct
ccaaatcttgcttatggcgctgctgcggctgctccccacaatggagtgcgtaatggtgct
ggtggtgcggatgagttcgaagatgaaattgataatgaagatttgatgatgttggatgcg
cagtag

DBGET integrated database retrieval system